SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g10250

Feature Type:gene_model
Chromosome:Gm08
Start:7412097
stop:7417112
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g10250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G14420AT Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein | chr3:4821804-4823899 FORWARD LENGTH=367 SoyBaseE_val: 0ISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008891GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolate oxidase activity SoyBaseN/AISS
GO:0010181GO-mf Annotation by Michelle Graham. GO Molecular Function: FMN binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0538 KOG Glycolate oxidase JGI ISS
PTHR10578Panther (S)-2-HYDROXY-ACID OXIDASE-RELATED JGI ISS
PF01070PFAM FMN-dependent dehydrogenase JGI ISS
UniRef100_H2D5S6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycolate oxidase n=1 Tax=Gossypium hirsutum RepID=H2D5S6_GOSHI SoyBaseE_val: 0ISS
UniRef100_I1KRU6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRU6_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g10250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g10250
ParalogEvidenceComments
Glyma05g27300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g10250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g096800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g10250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g10250
>Glyma08g10250.1   sequence type=CDS   gene model=Glyma08g10250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATGGAGATGATAACTAATGTTACCGAGTATGAGGCAATTGCAAAGGAAAAATTGCCAAAGATGGTTTATGACTACTATGCATCAGGGGCAGAGGATCAGTGGACTTTGAAGGAGAACCGAAATGCATTCTCAAGGATTCTGTTCCGGCCGCGTATTCTTGTTGATGTGAGCAAGATAGACTTGACTGCAACTGTATTGGGCTTCAAAATATCAATGCCTATCATGATTGCTCCAACAGCCATGCAAAAGATGGCTCACCCTGAAGGAGAATTAGCTACTGCTAGAGCAGCATCAGCAGCTGGCACAATCATGACACTATCCTCATGGGCTACTTCCAGTGTTGAGGAGGTTGCTTCAACAGGTCCTGACATTCGTTTTTTTCAACTTTATGTGTTTAAAGACAGAAATGTGGTTGCTCAGCTTGTGAGAAGAGCTGAAAGAGCTGGTTTCAAGGCAATTGCCCTTACTGTCGACACTCCAATTCTTGGTCGTAGGGAGGCTGACATCAAAAACAGATTTACATTGCCACCAAACCTGGTTTTGAAGAATTTTGAAGGATTGGATCTTGGAAAGCTGGACAAGACTAGTGACTCCGGTCTTGCCTCTTATGTTGCTGGACAAATTGATCGGTCACTCAACTGGAAGGATATCAAATGGCTTCAATCAATCACTTCATTGCCAATTTTAGTTAAGGGTGTCCTTACTGCTGAAGATACAAGGTTAGCCATACAAGCTGGAGCTGCTGGAATCATTGTTTCCAATCACGGAGCTCGTCAACTTGACTATGTCCCTGCAACTATTATGGCTTTGGAAGAGGTAGTTAAAGCTGCACAAGGAAAAATTCCAGTTTTTCTGGATGGTGGAATTCGCCGAGGGACAGATGTTTTTAAAGCACTAGCTCTTGGAGCAGCTGGTGTATTCATTGGTAGGCCTGTGGTGTTCTCATTGGCTGCTGATGGTGAGACTGGTGTGAGAAAAGTACTTCAAATGCTTCGTGATGAATTTGAACTAACAATGGCACTAAGTGGTTGCCGTTCGCTCAAGGAGATAACTCGTGACCATGTTGTCACAGAGTGGGATCACCCAAGATTTTCTCCCAAGTTATAA
Predicted protein sequences of Glyma08g10250
>Glyma08g10250.1   sequence type=predicted peptide   gene model=Glyma08g10250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMEMITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKIDLTATVLGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVASTGPDIRFFQLYVFKDRNVVAQLVRRAERAGFKAIALTVDTPILGRREADIKNRFTLPPNLVLKNFEGLDLGKLDKTSDSGLASYVAGQIDRSLNWKDIKWLQSITSLPILVKGVLTAEDTRLAIQAGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGKIPVFLDGGIRRGTDVFKALALGAAGVFIGRPVVFSLAADGETGVRKVLQMLRDEFELTMALSGCRSLKEITRDHVVTEWDHPRFSPKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo