SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g10220

Feature Type:gene_model
Chromosome:Gm08
Start:7389999
stop:7392203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g10220
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30135AT Annotation by Michelle Graham. TAIR10: jasmonate-zim-domain protein 8 | chr1:10596516-10597095 FORWARD LENGTH=131 SoyBaseE_val: 8.00E-25ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF06200PFAM tify domain JGI ISS
PF09425PFAM Divergent CCT motif JGI ISS
UniRef100_C6SVN6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVN6_SOYBN SoyBaseE_val: 2.00E-104ISS
UniRef100_I3WTA4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Jasmonate ZIM domain protein f n=1 Tax=Nicotiana attenuata RepID=I3WTA4_NICAT SoyBaseE_val: 2.00E-32ISS

Expression Patterns of Glyma08g10220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g10220
ParalogEvidenceComments
Glyma05g27280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g10220 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g096500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g10220
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g10220
>Glyma08g10220.1   sequence type=CDS   gene model=Glyma08g10220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAGAATTGCAACTTGGAGCTTCGCCTTTTCCCTCCTTCCCTCTCCGATCTTCGCCCCATGATGGAAGCAGAAGTTAGTGAGAGACCCCAACAACAGGTCGCCCACCATCAACAGCAACAGCAACCACAACCACAACATCCGCTGACCATTTTCTATGATGGCAAGATTTCAGTTTCAGATGTCACAGAGCTTCAGGCCAGATCCATATTAATGCTAGCAAATAAAGAGATGGAGAAAAGAGTGATGACACCAACGGGGTCAGAACCATCTTCACCAATATTACTGCAATCACCTCATAACATGTATAGCCCCGGCACTGGACTTTCCATGAAAAGATCACTGCAGAGGTTTCTCCAGAAGAGAAAGAATCGTGTCCAAGAAACATCCCCATACCATCACGAGCTAATTAATGTTAAATTATCAAAATCATCAAGGGAAAACAAATGA
Predicted protein sequences of Glyma08g10220
>Glyma08g10220.1   sequence type=predicted peptide   gene model=Glyma08g10220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKNCNLELRLFPPSLSDLRPMMEAEVSERPQQQVAHHQQQQQPQPQHPLTIFYDGKISVSDVTELQARSILMLANKEMEKRVMTPTGSEPSSPILLQSPHNMYSPGTGLSMKRSLQRFLQKRKNRVQETSPYHHELINVKLSKSSRENK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo