Glyma08g10166 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g10166

Feature Type:	gene_model
Chromosome:	Gm08
Start:	7324616
stop:	7324951
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g10166

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_I1K3E8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K3E8_SOYBN	SoyBase	E_val: 3.00E-60	ISS
UniRef100_Q9FQZ5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Avr9/Cf-9 rapidly elicited protein 169 n=1 Tax=Nicotiana tabacum RepID=Q9FQZ5_TOBAC	SoyBase	E_val: 2.00E-08	ISS

Proteins Associated with Glyma08g10166

Locus	Gene Symbol	Protein Name
	VQ33	VQ motif containing protein gene 33

Expression Patterns of Glyma08g10166

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g10166 not represented in the dataset	Glyma08g10166 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g10166

Paralog	Evidence	Comments
Glyma05g27220	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g10166 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g096000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g10166

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g10166

Limit To All Plant Sequences

>Glyma08g10166.1   sequence type=CDS   gene model=Glyma08g10166   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGAGTGGACCAAAGATAGTGCACATCGAAACACGGTACGTGGAAACCGATGCCATAAACTTCAGAGATGTGGTTCAGCACCTCACAGGGAAGAACTCGTCAACAACAAATTGGGACGTAGGAAATGGTGCCTTATTCTCATCCCTGCCAGGTTCTTCAGATTACAACAAAAGAGGAATTGCAAATGGTGGTGTCAGTGCCAAGCCACACACCACCACTAATGGTAAAAAGAATAGTGTTGCATCTTCCATGCTACTCATGAACGTGTCCTTCAAAGACTTTGAGGATTTGTTGTCTGATATGCCTCCCATGGAGGAGTTGCTCAAGTTGTAG

Predicted protein sequences of Glyma08g10166

Limit To All Plant Sequences

>Glyma08g10166.1   sequence type=predicted peptide   gene model=Glyma08g10166   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSGPKIVHIETRYVETDAINFRDVVQHLTGKNSSTTNWDVGNGALFSSLPGSSDYNKRGIANGGVSAKPHTTTNGKKNSVASSMLLMNVSFKDFEDLLSDMPPMEELLKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain