SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g10140

Feature Type:gene_model
Chromosome:Gm08
Start:7298125
stop:7302004
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g10140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G14920AT Annotation by Michelle Graham. TAIR10: GRAS family transcription factor family protein | chr1:5149414-5151015 FORWARD LENGTH=533 SoyBaseE_val: 0ISS
GO:0006808GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009938GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010233GO-bp Annotation by Michelle Graham. GO Biological Process: phloem transport SoyBaseN/AISS
GO:0010325GO-bp Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0048444GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ morphogenesis SoyBaseN/AISS
GO:2000033GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed dormancy process SoyBaseN/AISS
GO:2000377GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF03514PFAM GRAS family transcription factor JGI ISS
PF12041PFAM Transcriptional regulator DELLA protein N terminal JGI ISS
UniRef100_E3NYP4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin insensitive-like protein n=1 Tax=Glycine max RepID=E3NYP4_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1KRT7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRT7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g10140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g10140
ParalogEvidenceComments
Glyma05g27190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g10140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g095800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g10140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g10140
>Glyma08g10140.1   sequence type=CDS   gene model=Glyma08g10140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGGGAACGCGAGCAGCTTGGTTCCATCGCAGGGACCTCAAGCTGCGGTTATTCAAGCGGAAAATCGAATCTTTGGGAGGAAGAAGGAGGCATGGACGAGCTTCTTGCGGTGGTGGGTTACAAGGTTAGGTCATCGGACATGGCGGAAGTGGCGCAGAAGCTTGAGCGTCTCGAAGAAGCCATGGGAAATGTCCAAGATGACCTCCCGGAGATTTCAAACGACGTCGTTCATTACAACCCTTCCGACATCTCCAACTGGCTCGAAACCATGCTTTCTAATTTTGACCCTCTCCCCTCCGAAGAGCCGGAAAAGGACTCCGCCTCGTCGGACTACGATCTTAAGGCTATTCCGGGGAAAGCAATTTATGGAGCTAGCGACGCGCTACCAAACCCTAAGCGCGTGAAAGCCGACGAGTCAAGGCGCGCGGTGGTGGTCGTTGACTCGCAGGAGAACGGGATCCGCCTCGTGCACAGCCTCATGGCGTGCGCGGAGGCCGTGGAGAACAACAACCTCGCCGTGGCGGAGGCGCTGGTGAAGCAGATCGGCTTCCTCGCTGTGTCGCAGGTTGGAGCTATGAGGAAAGTCGCAATCTACTTCGCCGAAGCGCTCGCGAGGCGAATCTACAGAGTCTTCCCTCTGCAACACTCTCTCTCCGATTCTCTTCAGATTCACTTCTACGAAACCTGTCCATACCTCAAGTTCGCACACTTCACCGCGAACCAGGTTATCCTCGAAGCGTTCCAAGGAAAGAACCGCGTTCACGTGATTGATTTCGGTATCAACCAGGGGATGCAGTGGCCGGCGCTGATGCAAGCCCTAGCGGTTCGCACCGGCGGTCCTCCGGTTTTCCGACTCACCGGAATCGGGCCGCCGGCGGCGGACAACTCCGACCACCTCCAGGAGGTAGGGTGGAAGCTCGCGCAGCTGGCGGAGGAGATCAACGTGCAGTTCGAGTACCGTGGCTTCGTCGCGAACAGCCTCGCCGATCTCGACGCCTCCATGCTCGATCTCCGGGAAGGCGAAGCCGTCGCTGTGAACTCTGTCTTCGAGTTTCACAAGCTCCTCGCCCGCCCCGGCGCGGTGGAGAAAGTACTCTCCGTCGTACGGCAGATTCGGCCGGAGATTGTCACCGTCGTCGAGCAAGAAGCGAACCACAACAGACTGAGTTTTGTCGACCGGTTCACGGAGTCACTGCACTATTATTCAACCCTATTCGACTCGCTGGAGGGTTCGCCTGTGAACCCTAACGATAAGGCCATGTCGGAGGTTTACTTAGGGAAGCAAATCTGCAACGTGGTGGCGTGCGAGGGAATGGACCGCGTGGAAAGGCACGAGACGCTGAACCAGTGGCGGAACCGGTTCGTTTCGACCGGATTTTCTTCGGTTCACTTGGGTTCGAACGCGTACAAGCAGGCCAGCATGTTGCTCGCGCTTTTTGCGGGTGGGGATGGGTATAGGGTGGAAGAGAACAATGGTTGTCTCATGTTGGGATGGCACACTAGGCCCTTGATTGCCACCTCCGCGTGGCAACTCGCTGCAACTCGCTGA
Predicted protein sequences of Glyma08g10140
>Glyma08g10140.1   sequence type=predicted peptide   gene model=Glyma08g10140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKREREQLGSIAGTSSCGYSSGKSNLWEEEGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGNVQDDLPEISNDVVHYNPSDISNWLETMLSNFDPLPSEEPEKDSASSDYDLKAIPGKAIYGASDALPNPKRVKADESRRAVVVVDSQENGIRLVHSLMACAEAVENNNLAVAEALVKQIGFLAVSQVGAMRKVAIYFAEALARRIYRVFPLQHSLSDSLQIHFYETCPYLKFAHFTANQVILEAFQGKNRVHVIDFGINQGMQWPALMQALAVRTGGPPVFRLTGIGPPAADNSDHLQEVGWKLAQLAEEINVQFEYRGFVANSLADLDASMLDLREGEAVAVNSVFEFHKLLARPGAVEKVLSVVRQIRPEIVTVVEQEANHNRLSFVDRFTESLHYYSTLFDSLEGSPVNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFVSTGFSSVHLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAATR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo