SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g10061

Feature Type:gene_model
Chromosome:Gm08
Start:7236100
stop:7237514
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g10061
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70760AT Annotation by Michelle Graham. TAIR10: inorganic carbon transport protein-related | chr1:26687267-26688201 FORWARD LENGTH=191 SoyBaseE_val: 6.00E-45ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010598GO-cc Annotation by Michelle Graham. GO Cellular Compartment: NAD(P)H dehydrogenase complex (plastoquinone) SoyBaseN/AISS
GO:0042651GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid membrane SoyBaseN/AISS
GO:0016655GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor SoyBaseN/AISS
PF10716PFAM NADH dehydrogenase transmembrane subunit JGI ISS
UniRef100_C6T2V2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2V2_SOYBN SoyBaseE_val: 4.00E-100ISS
UniRef100_F8SVT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase subunit NdhL n=1 Tax=Wolffia australiana RepID=F8SVT7_9ARAE SoyBaseE_val: 6.00E-32ISS

Expression Patterns of Glyma08g10061
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g10061 not represented in the dataset
Glyma08g10061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g10061
ParalogEvidenceComments
Glyma05g27081 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g10061 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g095100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g10061
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g10061
>Glyma08g10061.1   sequence type=CDS   gene model=Glyma08g10061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTTCACATTCAACCTCCATGTTCCCAAAGCTCTGCCTCCTCTTCCCTCTTCATCACGTGGAACAACTTCTCTCTTCTTTTCTTCAAAGCAGAAATCATACCACAACAACACTAGTCCTTGCCAATCACTACTTTTGAGTGTAGCAGTGACTGGAGAGAATAACCGGCCAGAACTCATCTGGGTTTTGACCCAATGGGGGGTTGTTCTCTTTGGATATTTCCTTGTCGTGCCACCAATAATCTTTTACTGGCTTTGGAAAAGATGGTACAGAAGAAACTTGCTGGAGATGTATTTACAATTCATGTGTGTCTTCATTTTCTTCCCAGGGGTTCTTCTTTGGGCACCATTTTTAAACTTCAGGAAATTCCCTCGGGACACTTCCTTGCAGTACCCTTGGTCTGTACCTGAAGATCCTTCAAAAATTAGAAGTTCATACGCAAAGTACCCATATGCCGAACCTGAAGATTATGATAATCTATGA
Predicted protein sequences of Glyma08g10061
>Glyma08g10061.1   sequence type=predicted peptide   gene model=Glyma08g10061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFTFNLHVPKALPPLPSSSRGTTSLFFSSKQKSYHNNTSPCQSLLLSVAVTGENNRPELIWVLTQWGVVLFGYFLVVPPIIFYWLWKRWYRRNLLEMYLQFMCVFIFFPGVLLWAPFLNFRKFPRDTSLQYPWSVPEDPSKIRSSYAKYPYAEPEDYDNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo