SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g09571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g09571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g09571

Feature Type:gene_model
Chromosome:Gm08
Start:6806025
stop:6809575
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G02620AT Annotation by Michelle Graham. TAIR10: vacuolar ATPase subunit F family protein | chr4:1149419-1151132 REVERSE LENGTH=128 SoyBaseE_val: 1.00E-78ISS
GO:0015991GO-bp Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0033178GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, catalytic domain SoyBaseN/AISS
GO:0033180GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting V-type ATPase, V1 domain SoyBaseN/AISS
GO:0046933GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism SoyBaseN/AISS
GO:0046961GO-mf Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism SoyBaseN/AISS
KOG3432 KOG Vacuolar H+-ATPase V1 sector, subunit F JGI ISS
PTHR13861Panther VACUOLAR ATP SYNTHASE SUBUNIT F JGI ISS
PF01990PFAM ATP synthase (F/14-kDa) subunit JGI ISS
UniRef100_C6SVI1UniRef Annotation by Michelle Graham. Best UniRef hit: V-type proton ATPase subunit F n=1 Tax=Glycine max RepID=C6SVI1_SOYBN SoyBaseE_val: 5.00E-89ISS
UniRef100_C6SVI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: V-type proton ATPase subunit F n=1 Tax=Glycine max RepID=C6SVI1_SOYBN SoyBaseE_val: 5.00E-89ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g09571 not represented in the dataset

Glyma08g09571 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g26580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g090500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g09571.1   sequence type=CDS   gene model=Glyma08g09571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACAGAGTTCAAATTCCTACCAACAATTCAGCCCTCATTGCTATGATTGCAGATGAGGATACTGTAGTTGGATTTCTGTTGGCTGGAGTGGGAAATGTTGACATACGTAGGAAGACAAATTACCTCATTGTGGATTCAAAAACAACTGTCAAACAAATTGAGGATGCATTCAAAGAATTTACAACAAGGGAGGATGTTGCAATTGTGCTGATTAGCCAATATGTTGCAAATATGATAAGGTTTTTGGTTGATAGCTATAACAAGCCTGTTCCTGCAATACTTGAAATCCCTTCTAAAGACCATCCTTATGATCCAGCACATGATTCAGTTCTGTCACGAGTGAAGTATCTCTTCAATACCGAATCAGTTGCATCTGGGAGACGCTGA

>Glyma08g09571.1   sequence type=predicted peptide   gene model=Glyma08g09571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANRVQIPTNNSALIAMIADEDTVVGFLLAGVGNVDIRRKTNYLIVDSKTTVKQIEDAFKEFTTREDVAIVLISQYVANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLFNTESVASGRR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo