SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g09480

Feature Type:gene_model
Chromosome:Gm08
Start:6773010
stop:6776000
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g09480
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G45680AT Annotation by Michelle Graham. TAIR10: FK506-binding protein 13 | chr5:18530894-18532128 FORWARD LENGTH=208 SoyBaseE_val: 5.00E-76ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0018208GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005528GO-mf Annotation by Michelle Graham. GO Molecular Function: FK506 binding SoyBaseN/AISS
KOG0544 KOG FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR10516Panther FK506 BINDING PROTEIN JGI ISS
PF00254PFAM FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
UniRef100_C6TFQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6TFQ0_SOYBN SoyBaseE_val: 2.00E-154ISS
UniRef100_C6TFQ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6TFQ0_SOYBN SoyBaseE_val: 2.00E-154ISS

Expression Patterns of Glyma08g09480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g09480
ParalogEvidenceComments
Glyma05g26506 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g09480 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g089700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g09480
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g09480
>Glyma08g09480.1   sequence type=CDS   gene model=Glyma08g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTAGTGGCACCTTACTCTGCTGGAACATGTCTTCCTTCCCTTCAACGCCTTCCAACCCTGCAAGCCCAAAAATGGAACAACTTCTCAGCACCTCTTAGTTGCCACCGCCAAGTGAAATGTGCTGTCCAAGTCCAACCACAAGTAGCACCACGAATTACACCTGATGAGAGCCTGCAGGTGAAGAGAAGAACTCTCATAGGCCTTCTAGCATTTGATGCTGTCCTTGCTTATTCTTCATTGCAAGCAGCACCAGCAGCTGAAAATCCGTGTGAATTTCAAGTGGCACCTTCAGGCCTTGCCTTCTGTGACAAACTTGTGGGAGCTGGTCCTCAAGCAGTGAAGGGACAGCTTATTAAGGCGCATTATGTGGGGAGATTGGAGAATGGGAAAGTTTTCGATAGCAGCTACAATCGTGGCAAGCCACTAACCTTTCGCGTCGGTGTTGGAGAGGTCATTAAAGGTTGGGATGAAGGCATTATAGGAGGTGATGGAGTTCCCCCCATGCTTGCAGGAGGGAAACGTACACTGAAGATTCCTCCAGAACTTGGATATGGCTCAAGAGGGGCTGGTTGTAGGGGAGGTTCATGTATCATTCCTCCTGATTCGGTATTATTGTTTGACGTGGAGTTCGTTAGCAAAGCATGA
Predicted protein sequences of Glyma08g09480
>Glyma08g09480.1   sequence type=predicted peptide   gene model=Glyma08g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLVAPYSAGTCLPSLQRLPTLQAQKWNNFSAPLSCHRQVKCAVQVQPQVAPRITPDESLQVKRRTLIGLLAFDAVLAYSSLQAAPAAENPCEFQVAPSGLAFCDKLVGAGPQAVKGQLIKAHYVGRLENGKVFDSSYNRGKPLTFRVGVGEVIKGWDEGIIGGDGVPPMLAGGKRTLKIPPELGYGSRGAGCRGGSCIIPPDSVLLFDVEFVSKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo