Glyma08g09391 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g09391

Feature Type:	gene_model
Chromosome:	Gm08
Start:	6709690
stop:	6710867
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g09391

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G47278	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 37 Blast hits to 37 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 36; Viruses - 0; Other Eukaryotes - 1 (source: NCBI BLink). \| chr1:17331383-17331726 FORWARD LENGTH=80	SoyBase	E_val: 8.00E-33	ISS
UniRef100_I1KRK7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KRK7_SOYBN	SoyBase	E_val: 4.00E-52	ISS

Expression Patterns of Glyma08g09391

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g09391 not represented in the dataset	Glyma08g09391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g09391

Paralog	Evidence	Comments
Glyma05g26470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g09391 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g088800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g09391

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g09391

Limit To All Plant Sequences

>Glyma08g09391.1   sequence type=CDS   gene model=Glyma08g09391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGGAAAGCTGGTACGCTTTTTATCAACCCCAAGAGATTCGGTAATCTTCAAAAACCTTGCATGAAGGAAATGGCATTGTTTCTCAGTTGTATGGCTGCAAACCATAGTGACACCGAAGCCTGTGCTCGTCAGAAGGAGCTATTGAATGTCTGTATTGATGCTCAGAGTAAAAAGAACAGAAAGTCTTGGGGGAGTATCAATTATCAACTGCAGAGGCTTAACCGAGGAAGGAAGTAA

Predicted protein sequences of Glyma08g09391

Limit To All Plant Sequences

>Glyma08g09391.1   sequence type=predicted peptide   gene model=Glyma08g09391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKAGTLFINPKRFGNLQKPCMKEMALFLSCMAANHSDTEACARQKELLNVCIDAQSKKNRKSWGSINYQLQRLNRGRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain