SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g09290

Feature Type:gene_model
Chromosome:Gm08
Start:6649878
stop:6653230
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g09290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20030AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr4:10846362-10847246 FORWARD LENGTH=152 SoyBaseE_val: 3.00E-45ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG0114 KOG Predicted RNA-binding protein (RRM superfamily) JGI ISS
PTHR24622Panther FAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_C6SXE6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXE6_SOYBN SoyBaseE_val: 2.00E-108ISS
UniRef100_G7JZL4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit G n=1 Tax=Medicago truncatula RepID=G7JZL4_MEDTR SoyBaseE_val: 7.00E-63ISS

Expression Patterns of Glyma08g09290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g09290
ParalogEvidenceComments
Glyma05g26381 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g09290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g087800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g09290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g09290
>Glyma08g09290.1   sequence type=CDS   gene model=Glyma08g09290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGAGATGAATATATTGGCTTCTTCGTTCTCTGGTTATGCAAAACCCTTTGTAAGAGTAAACCCTTCTCTTCTTACGCTCAGGGCATCTTCTCTGCGCCATGACTACCCTCTTGCAAGCAAAATTGTTGTCAAAAATTTACCATATTCTACCGGTGAGACTACTTTGCAGAAGGAATTTTCAAATTTTGGCAAGATAGCTGAAGTTAAAATGGTTAAAGATATGAACACAAAAAGATCTAAGGGTATTGCTTTCATTCAATATACATGTCAAGATGATGCCATGCTTGCACTAGAAACCATGGATCAGAAGGATTTTTATGGTCGAACAATCGGCGTGGAAATTGCAAGACTGGGTTGGGATGATTTTGGTGCATCCCCAAGGGCCTCAGGACCCCCAAAGAAGTGGGATTTGCCAGAGCAAGGGGAAGTGGTAGATTGCTGGTACTGA
Predicted protein sequences of Glyma08g09290
>Glyma08g09290.1   sequence type=predicted peptide   gene model=Glyma08g09290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMEMNILASSFSGYAKPFVRVNPSLLTLRASSLRHDYPLASKIVVKNLPYSTGETTLQKEFSNFGKIAEVKMVKDMNTKRSKGIAFIQYTCQDDAMLALETMDQKDFYGRTIGVEIARLGWDDFGASPRASGPPKKWDLPEQGEVVDCWY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo