Glyma08g09200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g09200

Feature Type:	gene_model
Chromosome:	Gm08
Start:	6581287
stop:	6583572
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g09200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74270	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L35Ae family protein \| chr1:27928415-27929466 REVERSE LENGTH=112	SoyBase	E_val: 2.00E-72	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0887	KOG	60S ribosomal protein L35A/L37	JGI		ISS
PTHR10902	Panther	60S RIBOSOMAL PROTEIN L35A	JGI		ISS
PF01247	PFAM	Ribosomal protein L35Ae	JGI		ISS
UniRef100_B6VC50	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L35a n=1 Tax=Vernicia fordii RepID=B6VC50_VERFO	SoyBase	E_val: 8.00E-74	ISS
UniRef100_C6SXC3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXC3_SOYBN	SoyBase	E_val: 1.00E-75	ISS

Expression Patterns of Glyma08g09200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g09200

Paralog	Evidence	Comments
Glyma05g26290	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g09200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g087000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g09200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma08g09200

Limit To All Plant Sequences

>Glyma08g09200.4   sequence type=transcript   gene model=Glyma08g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTAGTTCTTCCTTTCCCTATAAAACCCCTAAAAACCCATATTCCGATAGTTCTAGTCTAGGGTTACGCCGTCGTCGCTGTTTGTGTGTGTATCAGGTGCAGCTACCAACGATGGTGAAGGGTCGTCAAGGAGAGCGCGTCAGACTCTACGTGAGGGGTACAATCCTTGGATACAAAAGGTCCAAGTCCAACCAGTACCCAAACACATCCCTGATCCAAATTGAGGGAGTGAACACCAAAGAAGAAGTAGGATGGTATGCTGGCAAGAAAATGGCCTATATCTACAAGGCTAAGGTGAAAAAGGATGGAAGCCATTACCGCTGCATATGGGGCAAGGTTACGAGGCCTCACGGCAACAGTGGTGTTGTCCGTGCAAAATTCAAGTCAAACCTTCCACCCAGATCGATGGGAGCTCGAGTAAGAGTATTCATGTATCCAAGTAATATATGAGGTGATAAGACGCTCAGAATTCGCAGCTTAATAGTAGGCACAAGGATTTTTGTTTCAGCTTTGATAATTTTGTTGTCTGTCAACTTTTTGAGAATTTTCCTTACGGTTTAGACGTTCATTTGAACGAATGTTTTTCTCCGTTATTATAGCTATTGTCTATGAAGATTATATATTCATTACTATGAAGCGTGTGGATTTGGTTACCTTGAATGTTCGCATTTCTATTCCCGATTTTCATTTGACAAAGTTACTCGGCTCCATCCATCGTAATTGTGCGTGTGTTGCTTAATAGAATTTAATTATTGACTGTATATTTTTGCATAGCTTTTACTTTTTGGTTCACTTTTG

Coding sequences of Glyma08g09200

Limit To All Plant Sequences

>Glyma08g09200.3   sequence type=CDS   gene model=Glyma08g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGGGTCGTCAAGGAGAGCGCGTCAGACTCTACGTGAGGGGTACAATCCTTGGATACAAAAGGTCCAAGTCCAACCAGTACCCAAACACATCCCTGATCCAAATTGAGGGAGTGAACACCAAAGAAGAAGTAGGATGGTATGCTGGCAAGAAAATGGCCTATATCTACAAGGCTAAGGTGAAAAAGGATGGAAGCCATTACCGCTGCATATGGGGCAAGGTTACGAGGCCTCACGGCAACAGTGGTGTTGTCCGTGCAAAATTCAAGTCAAACCTTCCACCCAGATCGATGGGAGCTCGAGTAAGAGTATTCATGTATCCAAGTAATATATGA

>Glyma08g09200.4   sequence type=CDS   gene model=Glyma08g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGGGTCGTCAAGGAGAGCGCGTCAGACTCTACGTGAGGGGTACAATCCTTGGATACAAAAGGTCCAAGTCCAACCAGTACCCAAACACATCCCTGATCCAAATTGAGGGAGTGAACACCAAAGAAGAAGTAGGATGGTATGCTGGCAAGAAAATGGCCTATATCTACAAGGCTAAGGTGAAAAAGGATGGAAGCCATTACCGCTGCATATGGGGCAAGGTTACGAGGCCTCACGGCAACAGTGGTGTTGTCCGTGCAAAATTCAAGTCAAACCTTCCACCCAGATCGATGGGAGCTCGAGTAAGAGTATTCATGTATCCAAGTAATATATGA

Predicted protein sequences of Glyma08g09200

Limit To All Plant Sequences

>Glyma08g09200.3   sequence type=predicted peptide   gene model=Glyma08g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKKMAYIYKAKVKKDGSHYRCIWGKVTRPHGNSGVVRAKFKSNLPPRSMGARVRVFMYPSNI*

>Glyma08g09200.4   sequence type=predicted peptide   gene model=Glyma08g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKKMAYIYKAKVKKDGSHYRCIWGKVTRPHGNSGVVRAKFKSNLPPRSMGARVRVFMYPSNI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain