SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g08930

Feature Type:gene_model
Chromosome:Gm08
Start:6364981
stop:6366619
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16950AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:5572640-5572939 FORWARD LENGTH=99 SoyBaseE_val: 9.00E-24ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T5P1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5P1_SOYBN SoyBaseE_val: 4.00E-61ISS
UniRef100_G7KAM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone acetyltransferase type B subunit n=1 Tax=Medicago truncatula RepID=G7KAM7_MEDTR SoyBaseE_val: 1.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g25990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g084500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g08930.1   sequence type=CDS   gene model=Glyma08g08930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGCGAGGATGCGAAAGATCCGTTCAAAGGGGTGGATTGGAAGGCCGTTGGTGGCGAGATGCAGCAAAATCCGAGTGCTAAACCAGCATTGAAGAAACGATTACCAAAGAAAGTTAGGGAAATTCCTGAATTCTATTTCCTTCCACGATGGCCGCTACCCAAAGCCATTTTATTCTGCAGCGCATGCATTGGTGGTGGTGTAGCTGCTGGAATGCTTTTAGAGACCTGGATTGAAAAGAAAGTTAAAGAAGATGGAGGGGTTATATGGGAATTTGACAAATAA

>Glyma08g08930.1   sequence type=predicted peptide   gene model=Glyma08g08930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSEDAKDPFKGVDWKAVGGEMQQNPSAKPALKKRLPKKVREIPEFYFLPRWPLPKAILFCSACIGGGVAAGMLLETWIEKKVKEDGGVIWEFDK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo