Glyma08g08840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g08840

Feature Type:	gene_model
Chromosome:	Gm08
Start:	6312551
stop:	6316098
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g08840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G34450	AT	Annotation by Michelle Graham. TAIR10: HMG-box (high mobility group) DNA-binding family protein \| chr2:14527918-14529448 REVERSE LENGTH=151	SoyBase	E_val: 8.00E-51	ISS
GO:0006333	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0381	KOG	HMG box-containing protein	JGI		ISS
PTHR13711	Panther	SWI/SNF-RELATED CHROMATIN BINDING PROTEIN	JGI		ISS
PTHR13711:SF70	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00505	PFAM	HMG (high mobility group) box	JGI		ISS
UniRef100_B9S139	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding protein MNB1B, putative n=1 Tax=Ricinus communis RepID=B9S139_RICCO	SoyBase	E_val: 1.00E-49	ISS
UniRef100_I1KRE8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRE8_SOYBN	SoyBase	E_val: 1.00E-102	ISS

Expression Patterns of Glyma08g08840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g08840

Paralog	Evidence	Comments
Glyma05g25900	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g08840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g083600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g08840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g08840

Limit To All Plant Sequences

>Glyma08g08840.1   sequence type=CDS   gene model=Glyma08g08840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAAAAGGCAAAAGGGTCTCACTCTGCTTCTTCTGCCTCTGCATCTTCCCGCAAACTAGTGCTGAGGATTAAATCAAACGAGGGAATCAAGAGATCAGTGCGGCAGACTAATTCAAGAAAGAAACCCAAAGCAAAGCAAAAGAAGAACAAACAAATGTTTGATGCTATGAAACCCAAGAAACCTCCGACAGCTTTCTTCTACTTCTTGGAGGATTTTCGTAAAGAATTTCAAGAGCAGAATCCAGATGTAAAGTCAATGCGTGATATTGGCAAGGCATGTGGAGAGAAGTGGAAAACAATGACTTATGAGGAGAAGGTTCAATACTATGATATAGCAACAAAAAAACGTGAAGAATTTGATAACGCAATGGCTGAATTTAATAAGAAAATGGAAAATGGCGAGTTTGACGAAACTGATGATGAATCAGAGTTTGATGAGTAA

Predicted protein sequences of Glyma08g08840

Limit To All Plant Sequences

>Glyma08g08840.1   sequence type=predicted peptide   gene model=Glyma08g08840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKKAKGSHSASSASASSRKLVLRIKSNEGIKRSVRQTNSRKKPKAKQKKNKQMFDAMKPKKPPTAFFYFLEDFRKEFQEQNPDVKSMRDIGKACGEKWKTMTYEEKVQYYDIATKKREEFDNAMAEFNKKMENGEFDETDDESEFDE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain