SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g08770

Feature Type:gene_model
Chromosome:Gm08
Start:6268664
stop:6270567
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g08770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29930AT Annotation by Michelle Graham. TAIR10: chlorophyll A/B binding protein 1 | chr1:10478071-10478874 FORWARD LENGTH=267 SoyBaseE_val: 6.00E-169ISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_I1KRE3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=4 Tax=core eudicotyledons RepID=I1KRE3_SOYBN SoyBaseE_val: 0ISS
UniRef100_P09756UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein 3, chloroplastic n=1 Tax=Glycine max RepID=CB23_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g08770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g08770
ParalogEvidenceComments
Glyma05g25810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g08770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g082900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g08770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g08770
>Glyma08g08770.2   sequence type=CDS   gene model=Glyma08g08770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAGCTTCTTCCATGGCTCTCTCATCCCCATCCTTGGCTGGCAAGGCCGTGAAGCTGGGCCCATCAGCCCCAGAAGTGGGAAGGGTGAGCATGAGGAAGACCGTCACCAAGCAGGTCTCCTCAGGAAGCCCATGGTACGGCCCAGACCGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCGTCCTACCTAACCGGTGAGTTCCCAGGCGACTACGGCTGGGACACTGCTGGGCTTTCCGCAGACCCAGAAACCTTCGCCAAGAACCGTGAACTCGAAGTGATCCACTCCAGGTGGGCCATGCTCGGAGCCTTGGGCTGCGTCTTCCCGGAGTTGCTGTCCCGCAACGGGGTGAAGTTCGGAGAAGCCGTGTGGTTCAAGGCCGGGTCCCAGATCTTCAGCGAGGGTGGGCTCGACTACTTGGGCAACCCAAGCCTGATCCACGCCCAGAGCATCCTCGCCATCTGGGCCACACAAGTTATCCTAATGGGTGCCGTTGAAGGTTACCGTATTGCTGGTGGCCCCCTCGGTGAGGTCACTGACCCAATCTACCCAGGTGGCAGCTTCGACCCATTGGGCCTTGCTGATGACCCAGAGGCTTTTGCTGAGCTTAAGGTGAAGGAACTCAAGAACGGACGATTGGCCATGTTCTCTATGTTTGGCTTCTTTGTTCAGGCCATTGTCACCGGAAAGGGTCCATTGGAGAACCTCGCCGATCACCTTGCTGACCCTGTCAACAACAACGCCTGGGCCTATGCCACCAACTTCGTCCCCGGAAAGTGA
Predicted protein sequences of Glyma08g08770
>Glyma08g08770.2   sequence type=predicted peptide   gene model=Glyma08g08770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAASSMALSSPSLAGKAVKLGPSAPEVGRVSMRKTVTKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo