SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g08690

Feature Type:gene_model
Chromosome:Gm08
Start:6180462
stop:6184824
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g08690
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64520AT Annotation by Michelle Graham. TAIR10: regulatory particle non-ATPase 12A | chr1:23956459-23958120 FORWARD LENGTH=267 SoyBaseE_val: 3.00E-155ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009647GO-bp Annotation by Michelle Graham. GO Biological Process: skotomorphogenesis SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0031540GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048528GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic root development SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005838GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle SoyBaseN/AISS
GO:0008541GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, lid subcomplex SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG3151 KOG 26S proteasome regulatory complex, subunit RPN12/PSMD8 JGI ISS
PTHR12387Panther 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 8 JGI ISS
PF03399PFAM SAC3/GANP/Nin1/mts3/eIF-3 p25 family JGI ISS
UniRef100_B7FL82UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S proteasome non-ATPase regulatory subunit n=1 Tax=Medicago truncatula RepID=B7FL82_MEDTR SoyBaseE_val: 5.00E-175ISS
UniRef100_I1KRD4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRD4_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g08690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g08690
ParalogEvidenceComments
Glyma05g25730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g08690 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g082000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g08690
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g08690
>Glyma08g08690.1   sequence type=CDS   gene model=Glyma08g08690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCGAAGCTGAAAGAGGTTTCTCAGCTCTTCGATCGCTTCAAGGCTTCGTTTCTCCGGAACGACTTCGATAACTGTTCCAATCTCCTTTCTCAGCTAAAGGTGTTACTTACAGGTTTCAGAAGCCTGCCACCGTTGTTTGCAGATACACCTAATGCAGTTCATGAATTAACAATAGCAAGGGATATATATGAGCATGCTGTTGTCCTTAGTGTGAAAATTGAGGATCAAGATGCTTTCGAAAGGGATTTCTTCCAGTTGAAGCCTTATTATACAGATGCCTGCAATCGTCTTCCACCATCTCCTCAGGAGTACCCTATACTGGGTCTCAACCTGTTGAGACTACTTGTGCAGAATAGGATTGCTGAGTTCCATACTGAGTTGGAATTGCTTTCATCTGCTGCTCTTGAGAATCCTTGCATTAAGCATGCCGTGGAGTTAGAACAATCTTTTATGGAAGGGGCTTACAATCGTGTCTTGAGTGCACGGCAGACAGTGCCACATGATACATACGTTTATTTCATGGATCTTTTGGCAAAGACTGTCAGAGATGAAATAGCAGGTTGCAGTGAGAAGGCCTATGACTATCTTTCAATTAAGGATGCCAAGCAAATGTTGCTGTTCTCCTCAGACCAGGAACTCCTGGAATATATTAAAGAGGAGCATCCTGAGTGGGAGATTAAGAATGATAGTGTCTTTTTCCAAAAGGCAAAAGAATCTGCACCTTGCAAAGAAATACCCTCTCTGCAGCTCATCAACCAGACACTTAGTTATGCTAGGGAGTTGGAGAGGATTGTCTGA
Predicted protein sequences of Glyma08g08690
>Glyma08g08690.1   sequence type=predicted peptide   gene model=Glyma08g08690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPKLKEVSQLFDRFKASFLRNDFDNCSNLLSQLKVLLTGFRSLPPLFADTPNAVHELTIARDIYEHAVVLSVKIEDQDAFERDFFQLKPYYTDACNRLPPSPQEYPILGLNLLRLLVQNRIAEFHTELELLSSAALENPCIKHAVELEQSFMEGAYNRVLSARQTVPHDTYVYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAKQMLLFSSDQELLEYIKEEHPEWEIKNDSVFFQKAKESAPCKEIPSLQLINQTLSYARELERIV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo