Glyma08g08420 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g08420

Feature Type:	gene_model
Chromosome:	Gm08
Start:	6035230
stop:	6036485
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g08420

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09815	AT	Annotation by Michelle Graham. TAIR10: polymerase delta 4 \| chr1:3189460-3190050 FORWARD LENGTH=124	SoyBase	E_val: 3.00E-33	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity	SoyBase	N/A	ISS
PTHR14303	Panther	DNA POLYMERASE DELTA SUBUNIT 4	JGI		ISS
PF04081	PFAM	DNA polymerase delta, subunit 4	JGI		ISS
UniRef100_G8A1C1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase delta subunit n=1 Tax=Medicago truncatula RepID=G8A1C1_MEDTR	SoyBase	E_val: 2.00E-38	ISS
UniRef100_I1KRA4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KRA4_SOYBN	SoyBase	E_val: 3.00E-70	ISS

Expression Patterns of Glyma08g08420

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g08420

Paralog	Evidence	Comments
Glyma05g25400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g08420 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g079500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g08420

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g08420

Limit To All Plant Sequences

>Glyma08g08420.1   sequence type=CDS   gene model=Glyma08g08420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTAGTGTCCGGAAACATGAAGGGTTTTTACCGACAGAAAAAAACCATCGCCACCAAAAAATCTCCGATTCTCTCCCCGGCCATCATCTCCCTCGGCGGAAAACCCGACCTAGAAGATGAGCACAAGGAGAGCGAGGTGGTGCTGCGGCAATTCGACCTGAACATGGCGTACGGGCCTTGCCTCGGGATGACGAGGCTCGCACGGTGGGAGCGCGCACAGAGGCTCGACTTGAACCCTCCGCAGGAAATCGAGAGGCTTTTGAAGAGTGGGAAGGTTCCGACCGAGTCCTTGTGGGATGGTCGCATTTAG

Predicted protein sequences of Glyma08g08420

Limit To All Plant Sequences

>Glyma08g08420.1   sequence type=predicted peptide   gene model=Glyma08g08420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALVSGNMKGFYRQKKTIATKKSPILSPAIISLGGKPDLEDEHKESEVVLRQFDLNMAYGPCLGMTRLARWERAQRLDLNPPQEIERLLKSGKVPTESLWDGRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain