Glyma08g08030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g08030

Feature Type:	gene_model
Chromosome:	Gm08
Start:	5764985
stop:	5765551
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g08030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14320	AT	Annotation by Michelle Graham. TAIR10: Zinc-binding ribosomal protein family protein \| chr4:8242684-8243805 REVERSE LENGTH=105	SoyBase	E_val: 1.00E-60	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3464	KOG	60S ribosomal protein L44	JGI		ISS
PTHR10369	Panther	60S RIBOSOMAL PROTEIN L44	JGI		ISS
PF00935	PFAM	Ribosomal protein L44	JGI		ISS
UniRef100_G7L0P4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L44 n=2 Tax=Papilionoideae RepID=G7L0P4_MEDTR	SoyBase	E_val: 1.00E-62	ISS
UniRef100_I1K2S3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2S3_SOYBN	SoyBase	E_val: 3.00E-63	ISS

Expression Patterns of Glyma08g08030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g08030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g075500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g08030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g08030

Limit To All Plant Sequences

>Glyma08g08030.2   sequence type=CDS   gene model=Glyma08g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAACCTCATCTTCTTCAACTCTCATCCGTTTGATTGCACAATTTCTGATTTCAATTATGACAAAGAAGACCTACTGCAAGAGCAAGGAGTGCAGGAAGCACACGCTCCACAAGGTCACCCAATACAAGAAGGGCAAGGACAGCATCGCCGCTCAGGGAAAACGCCGTTATGACCGCAAACAGTCCGGTTACGGTGGCCAGACTAAGCCTGTTTTCCACAAAAAGGCCAAAACCACCAAGAAAATTGTGTTGAGGCTCCAGTGTCAGGGATGCAAGCATGTCTCGCAGCACGCTATCAAGAGGTGCAAGCATTTTGAGATCGGTGGTGACAAGAAGGGAAAAGGAACCTCTCTGTTCTAG

Predicted protein sequences of Glyma08g08030

Limit To All Plant Sequences

>Glyma08g08030.2   sequence type=predicted peptide   gene model=Glyma08g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTSSSSTLIRLIAQFLISIMTKKTYCKSKECRKHTLHKVTQYKKGKDSIAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHAIKRCKHFEIGGDKKGKGTSLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain