SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g08030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g08030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g08030

Feature Type:gene_model
Chromosome:Gm08
Start:5764985
stop:5765551
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g08030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14320AT Annotation by Michelle Graham. TAIR10: Zinc-binding ribosomal protein family protein | chr4:8242684-8243805 REVERSE LENGTH=105 SoyBaseE_val: 1.00E-60ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3464 KOG 60S ribosomal protein L44 JGI ISS
PTHR10369Panther 60S RIBOSOMAL PROTEIN L44 JGI ISS
PF00935PFAM Ribosomal protein L44 JGI ISS
UniRef100_G7L0P4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L44 n=2 Tax=Papilionoideae RepID=G7L0P4_MEDTR SoyBaseE_val: 1.00E-62ISS
UniRef100_I1K2S3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2S3_SOYBN SoyBaseE_val: 3.00E-63ISS

Expression Patterns of Glyma08g08030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g08030 not represented in the dataset
Glyma08g08030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g08030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g075500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g08030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g08030
>Glyma08g08030.2   sequence type=CDS   gene model=Glyma08g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAACCTCATCTTCTTCAACTCTCATCCGTTTGATTGCACAATTTCTGATTTCAATTATGACAAAGAAGACCTACTGCAAGAGCAAGGAGTGCAGGAAGCACACGCTCCACAAGGTCACCCAATACAAGAAGGGCAAGGACAGCATCGCCGCTCAGGGAAAACGCCGTTATGACCGCAAACAGTCCGGTTACGGTGGCCAGACTAAGCCTGTTTTCCACAAAAAGGCCAAAACCACCAAGAAAATTGTGTTGAGGCTCCAGTGTCAGGGATGCAAGCATGTCTCGCAGCACGCTATCAAGAGGTGCAAGCATTTTGAGATCGGTGGTGACAAGAAGGGAAAAGGAACCTCTCTGTTCTAG
Predicted protein sequences of Glyma08g08030
>Glyma08g08030.2   sequence type=predicted peptide   gene model=Glyma08g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTSSSSTLIRLIAQFLISIMTKKTYCKSKECRKHTLHKVTQYKKGKDSIAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHAIKRCKHFEIGGDKKGKGTSLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo