SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g07890

Feature Type:gene_model
Chromosome:Gm08
Start:5655579
stop:5658103
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64080AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr5:25645475-25646638 REVERSE LENGTH=182 SoyBaseE_val: 1.00E-45ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_G7KE52UniRef Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=G7KE52_MEDTR SoyBaseE_val: 8.00E-84ISS
UniRef100_I1KR47UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KR47_SOYBN SoyBaseE_val: 2.00E-123ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g24730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g074100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g07890.1   sequence type=CDS   gene model=Glyma08g07890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCAAAATTGACCCTCATTGCGTTGGTTCTCGCGGTGGCCCTGTGCGCCGTTGATCTAACCCATAGCGCATCAGCATCCTCCCCTCACGCGCCAGCGCCCTCCGTGGACTGCACCAACCTCGTCCTCACCATGGCCGACTGCTTGTCCTTCGTCACCAACGGTAGCACCGTCACCAAGCCAGAGGGCACATGCTGCTCCGGTTTGAAATCTGTTCTCAAAACTGCTCCGGCGTGCCTCTGCGAGGCTTTCAAGAGCAGCGCTCAGTTCGGCGTCGTTTTGAATGTCACCAAGGCCACCTCTCTCCCCGCCGCCTGCAAAGTTTCTGCTCCTTCTGCCACCAACTGTGGATTGTCTGAAACGCCTGCTGCTGCTCCTGCTGGAGGCCTCTCTCCACAAGCTTCTCCATCTCCTCAACAAGCAGATGCTTCAACTAATGGTCCTGTAAATGAGATATCTCCAGCACCAGCACCAGCCCAAGGGAACACAGCATCAGCATTATTCCCAATTTCTGCTGGGTCCTTGCTTCTTGGCATATTGGTAGCCACATTCTCAGGCTTCTGA

>Glyma08g07890.1   sequence type=predicted peptide   gene model=Glyma08g07890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKLTLIALVLAVALCAVDLTHSASASSPHAPAPSVDCTNLVLTMADCLSFVTNGSTVTKPEGTCCSGLKSVLKTAPACLCEAFKSSAQFGVVLNVTKATSLPAACKVSAPSATNCGLSETPAAAPAGGLSPQASPSPQQADASTNGPVNEISPAPAPAQGNTASALFPISAGSLLLGILVATFSGF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo