SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g07880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g07880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g07880

Feature Type:gene_model
Chromosome:Gm08
Start:5644327
stop:5645907
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15820AT Annotation by Michelle Graham. TAIR10: light harvesting complex photosystem II subunit 6 | chr1:5446685-5447676 REVERSE LENGTH=258 SoyBaseE_val: 4.00E-148ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0010196GO-bp Annotation by Michelle Graham. GO Biological Process: nonphotochemical quenching SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II antenna complex SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_I1KR46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KR46_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9XQB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a/b-binding protein CP24 n=1 Tax=Vigna radiata var. radiata RepID=Q9XQB6_VIGRR SoyBaseE_val: 8.00E-166ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g07880 not represented in the dataset

Glyma08g07880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g24660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g074000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g07880.1   sequence type=CDS   gene model=Glyma08g07880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTGCAACATCTAGTGCTGTGTTAAACGGGTTTGGATCTCACTTCTTGTGTGGAGGAAAGAGGAGCCATGCCCTTCTTGCTGCTAGCATTGGAGGGAAAGTTGGTGCTTCTGTTAGTCCTAAAAGAGTTATTGTGGCAGTTGCTGCTGCACCAAAGAAGTCATGGATCCCCGCTGTAAAAGGTGGTGGGAGTTTCATAGACCCAGAATGGCTTGATGGCTCGCTACCAGGTGACTATGGTTTTGACCCACTAGGACTAGGAAAGGACCCGGCATTCCTGAAATGGTATAGAGAAGCTGAACTCATTCATGGGAGGTGGGCAATGGCTGCAGTTGTAGGCATCTTCATTGGGCAGGCATGGAGTGGAGTTCCATGGTTTGAGGCTGGAGCAGATCCTAATGCAATTGCTCCTTTCTCATTTGGCTCTCTCTTAGGTACCCAGTTGCTCCTAATGGGGTGGGTTGAGAGCAAGAGATGGGTGGACTTCTTCAACCCAGATTCTCAGTCAGTGGAGTGGGCCACTCCATGGTCAAAAACTGCTGAGAACTTTGGCAACTCTACTGGTGAACAAGGCTACCCTGGAGGAAAATTCTTTGACCCTTTGGGATTTGCTGGAGCTATCAAGGATGGCGTTTACATTCCGGATGCCGACAAGCTAGAGAGACTGAAATTGGCTGAGATTAAGCATGCTAGGATTGCTATGTTGGCTATGCTGATTTTCTACTTTGAGGCTGGCCAGGGCAAGACACCCCTTGGTGCTCTTGGCTTGTAA

>Glyma08g07880.1   sequence type=predicted peptide   gene model=Glyma08g07880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAATSSAVLNGFGSHFLCGGKRSHALLAASIGGKVGASVSPKRVIVAVAAAPKKSWIPAVKGGGSFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFIGQAWSGVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFGNSTGEQGYPGGKFFDPLGFAGAIKDGVYIPDADKLERLKLAEIKHARIAMLAMLIFYFEAGQGKTPLGALGL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo