SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g07871

Feature Type:gene_model
Chromosome:Gm08
Start:5642371
stop:5644218
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g07871
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10160AT Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr5:3185819-3187159 FORWARD LENGTH=219 SoyBaseE_val: 8.00E-97ISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016836GO-mf Annotation by Michelle Graham. GO Molecular Function: hydro-lyase activity SoyBaseN/AISS
GO:0019171GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity SoyBaseN/AISS
PF07977PFAM FabA-like domain JGI ISS
UniRef100_D8KXZ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-hydroxyacyl-ACP dehydrase 1 n=1 Tax=Arachis hypogaea RepID=D8KXZ5_ARAHY SoyBaseE_val: 2.00E-99ISS
UniRef100_I1MDV8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MDV8_SOYBN SoyBaseE_val: 8.00E-100ISS

Expression Patterns of Glyma08g07871
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g07871 not represented in the dataset
Glyma08g07871 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g07871
ParalogEvidenceComments
Glyma05g24650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g07871 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g073900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g07871
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g07871
>Glyma08g07871.1   sequence type=CDS   gene model=Glyma08g07871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAACAACAGTCTCTGCACTCTCCAACACCTTCTTCATCTCTCAGATTTCCCAGCTCGAGATTTCAGCCTCTGGCTACCCAGTTGAGGAAAACAACCTGCTACAACATTTTTCTTCACCTTCCATTTTCTTACCCACGTGGTTTTCGTGTTTTGCCATTGTTGCTGGGTACCCTGCGTTTCCAACATCATTGGACATCAATAAGATTCGTGACATTCTGCCGCACAGGTTTCCATTTCTTCTAGTGGATAGAGTGATTGAACACAATCCTGGAGTTTCTGCAGTGGCCATAAAGAATGTGACAATAAATGACAACTTTTTTCCTGGGCATTTTCCTGAAAGACCAATCATGCCTGGTGTTCTCCTGGTTGAGGCAATGGCACAGGTTGGTGGCTTGGTTATGTTGCAACCTGAAATTGGAGGTTCTCGCAATAATTTCTTCTTTGCTGGAATAGACAAAGTGCGATTTAGGAAGCCAGTGATTGCAGGAGACACTTTAGTTATGAGAATGACACTTATCAAACTGCAAAAGCGATTTGGAATAGCAAAGATGGAAGGGAAGGCATATGTTGGAGGTGAAGTTGTGTGTGAGGGTGAGTTTCTGATGGCAACTGGGAGCGAATAA
Predicted protein sequences of Glyma08g07871
>Glyma08g07871.1   sequence type=predicted peptide   gene model=Glyma08g07871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTTVSALSNTFFISQISQLEISASGYPVEENNLLQHFSSPSIFLPTWFSCFAIVAGYPAFPTSLDINKIRDILPHRFPFLLVDRVIEHNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLLVEAMAQVGGLVMLQPEIGGSRNNFFFAGIDKVRFRKPVIAGDTLVMRMTLIKLQKRFGIAKMEGKAYVGGEVVCEGEFLMATGSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo