Glyma08g07520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g07520

Feature Type:	gene_model
Chromosome:	Gm08
Start:	5367574
stop:	5370488
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g07520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G60600	AT	Annotation by Michelle Graham. TAIR10: UbiA prenyltransferase family protein \| chr1:22324807-22326759 REVERSE LENGTH=382	SoyBase	E_val: 3.00E-140	ISS
GO:0009772	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II	SoyBase	N/A	ISS
GO:0010103	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0010236	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastoquinone biosynthetic process	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0042372	GO-bp	Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0004659	GO-mf	Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity	SoyBase	N/A	ISS
GO:0046428	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1,4-dihydroxy-2-naphthoate octaprenyltransferase activity	SoyBase	N/A	ISS
PTHR13929	Panther	1,4-DIHYDROXY-2-NAPHTHOATE OCTAPRENYLTRANSFERASE	JGI		ISS
PF01040	PFAM	UbiA prenyltransferase family	JGI		ISS
UniRef100_Q0WUA3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic n=2 Tax=Arabidopsis thaliana RepID=MENA_ARATH	SoyBase	E_val: 2.00E-137	ISS
UniRef100_UPI0002338FAB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338FAB related cluster n=1 Tax=unknown RepID=UPI0002338FAB	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g07520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g07520

Paralog	Evidence	Comments
Glyma13g08010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g07520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g070600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g07520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g07520

Limit To All Plant Sequences

>Glyma08g07520.2   sequence type=CDS   gene model=Glyma08g07520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GACTATGGAGGAAGGTTTTTACAAGTTGAAGGATGGCATCAACATCAGTATTTGTTATGTGCAAGAGGAGTTGAGTTGTCCCCTTCTGCCAATGAAGAAGTTGGAGAGGAGACTGAGGAGGATATCTCAAAGGAAACGTTGATTTGGAGAGCCATCAAGTTGCCAATTTACTCTGTTGCATTTGTTCCTCTCACTGTAGGCAGTGCAGCAGTTTATTTTCAGACAGGGATCTTCTCAGCTAGATGTTATTTTGTTCTCCTGGCTTCTTCAGTTCTTGCTATTACCTGGCTCAATTTAAGCAATGATGTTTATGATTTTGACACTGGAGTTGACAAGAACAAAAAGGAATCAGTTGTAAACCTGGCAGGTAGCCGTAAAGGAACCTTCATTGCTGCCTACTTGTGCCTTGCTATTGGCTTCCTTGGGCTGACTTGGACTGCTGTTGTGGAAAGAAACATACGTTCAATATTGTTTCTTGTTTGTGCAATTATTTGTGGCTATATATATCAGTGTCCACCATTTCGGTTAAGCTACCAGGGGCTGGGAGAGCCCTTGTGCTTTGCAGCATTTGGGCCTTTTGCCACTTGTGCCTTTTATTTATTACATGGCAGTTCAAGTGTGATGAACCATTTCCCCTTAAGTGGAACGGTTCTTTCAGCATCAATTCTTGTTGGCTTCACAACATCTCTTATCTTGTTTTGCAGTCATTTCCATCAGGTGGAAGGAGACAAGGAGGTTGGGAAAATGTCACCTTTGGTTAGACTTGGCACTAAAAAAGGTGCAGAGGTAGTGAAAGGGGCAGTCTTTATGCTCTATGCTCTTTTGGTTGCTTTTGGTCTAATCAAGGCACTTCCTCTCACTTGTATATTCCTTTGTGCATTGACCTTGCCGATGGGAAACCTGGTAGTTAGATTTGTCGAAGACAATTACAAGGCAATTGTATTCTCACAGAACAAAAATAAGATTTTCATGGCTAAGTACTTCTGTGTGAGGCTTCATGCATTGTTTGGAGTTGCACTGGCTTTAGGACTAGTGCTGGCTAGAAATACAAAATTTACATCATGGCCAATATTGAGTTGA

Predicted protein sequences of Glyma08g07520

Limit To All Plant Sequences

>Glyma08g07520.2   sequence type=predicted peptide   gene model=Glyma08g07520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DYGGRFLQVEGWHQHQYLLCARGVELSPSANEEVGEETEEDISKETLIWRAIKLPIYSVAFVPLTVGSAAVYFQTGIFSARCYFVLLASSVLAITWLNLSNDVYDFDTGVDKNKKESVVNLAGSRKGTFIAAYLCLAIGFLGLTWTAVVERNIRSILFLVCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSSSVMNHFPLSGTVLSASILVGFTTSLILFCSHFHQVEGDKEVGKMSPLVRLGTKKGAEVVKGAVFMLYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYKAIVFSQNKNKIFMAKYFCVRLHALFGVALALGLVLARNTKFTSWPILS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain