Report for Sequence Feature Glyma08g07420
Feature Type: gene_model
Chromosome: Gm08
Start: 5306532
stop: 5308348
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g07420
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G50011 AT
Annotation by Michelle Graham. TAIR10: conserved peptide upstream open reading frame 37 | chr5:20349114-20349380 FORWARD LENGTH=51
SoyBase E_val: 4.00E-23 ISS
UniRef100_G7KBG8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH143 n=1 Tax=Medicago truncatula RepID=G7KBG8_MEDTR
SoyBase E_val: 1.00E-21 ISS
UniRef100_I1KQZ9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQZ9_SOYBN
SoyBase E_val: 4.00E-31 ISS
Expression Patterns of Glyma08g07420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g07420
Paralog Evidence Comments
Glyma07g29980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g07420 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g069600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g07420
Coding sequences of Glyma08g07420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g07420.1 sequence type=CDS gene model=Glyma08g07420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGTGCCAAGCAGCGAGCCAAACAAGATTCCGGGCATTAAAACATGAGTATGGCATTGATGGTAAAGCAACAATTATTGTTAGAGTGATAGCATGCTTCCAACCCTTGCATTTTTGTCAGGCTGAGTACTTCCGTCATTTGCTTAAGCCTGTCACGTAG
Predicted protein sequences of Glyma08g07420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g07420.1 sequence type=predicted peptide gene model=Glyma08g07420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVCQAASQTRFRALKHEYGIDGKATIIVRVIACFQPLHFCQAEYFRHLLKPVT*