Report for Sequence Feature Glyma08g07260
Feature Type: gene_model
Chromosome: Gm08
Start: 5215213
stop: 5225206
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g07260
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G22540 AT
Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr2:9580417-9583603 FORWARD LENGTH=240
SoyBase E_val: 1.00E-66 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0009266 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus
SoyBase N/A ISS
GO:0009556 GO-bp
Annotation by Michelle Graham. GO Biological Process: microsporogenesis
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009910 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development
SoyBase N/A ISS
GO:0009965 GO-bp
Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis
SoyBase N/A ISS
GO:0010076 GO-bp
Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0010582 GO-bp
Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy
SoyBase N/A ISS
GO:0030154 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell differentiation
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0035304 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation
SoyBase N/A ISS
GO:0045892 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0048438 GO-bp
Annotation by Michelle Graham. GO Biological Process: floral whorl development
SoyBase N/A ISS
GO:0048481 GO-bp
Annotation by Michelle Graham. GO Biological Process: ovule development
SoyBase N/A ISS
GO:0052543 GO-bp
Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0000900 GO-mf
Annotation by Michelle Graham. GO Molecular Function: translation repressor activity, nucleic acid binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
KOG0014
KOG
MADS box transcription factor
JGI ISS
PTHR11945 Panther
MADS BOX PROTEIN
JGI ISS
PTHR11945:SF75 Panther
SVP (SHORT VEGETATIVE PHASE), TRANSCRIPTION FACTOR
JGI ISS
PF00319 PFAM
SRF-type transcription factor (DNA-binding and dimerisation domain)
JGI ISS
PF01486 PFAM
K-box region
JGI ISS
UniRef100_G7JV76 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Myocyte-specific enhancer factor 2B n=1 Tax=Medicago truncatula RepID=G7JV76_MEDTR
SoyBase E_val: 8.00E-93 ISS
UniRef100_I1KQY8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQY8_SOYBN
SoyBase E_val: 4.00E-143 ISS
Expression Patterns of Glyma08g07260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g07260
Paralog Evidence Comments
Glyma07g30040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g07260 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g068200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g07260
Coding sequences of Glyma08g07260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g07260.3 sequence type=CDS gene model=Glyma08g07260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACTAGAAAGAGGATACAGATCAAGAAAATCGACAACATCAGTTCCAGGCAAGTGACTTTCTCCAAGAGAAGGAAAGGGCTTTTCAAGAAGGCTCAGGAATTGTCAACCCTTTGTGATGCAGACATAGCTCTCATTGTTTTTTCTGCAACTAGCAAGCTCTTTGAGTATGCCAGTTCAAGTATGCATCAAGTAATTGAAAGGCGCGATAGCCATTCAGCAATGAATAGACTGGATCGCCCCTCAATTGAGCTGCAGATTGAGAATGACTCCAATGAAATCCTGCGCAAGAAAGTAGAAGATAAGAACCGTGAGCTGAGGCAGATGAATGGGGAAGATCTGCAAGGATTGACATTACAAGAACTGCATAAACTAGAGGAACACCTTAAAAGAGGTTTGATCAATGTTTCAAAAGTAAAGGATGAAAAACTTATGCAAGAGATCAGCACGCTTAAGAGAAAGGGAGTGGAACTAATGGAGGAAAACCAAAGACTGAAACAGGTACCGAGCCTTATCCATGTACATAGGCAATCATCGGAATCCATTCTTAGCAATTCATCTAACCTTCCTGAAGATGGTGGTAGCGACACATCTCTCAAGTTGGGGTTACCTTAA
Predicted protein sequences of Glyma08g07260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g07260.3 sequence type=predicted peptide gene model=Glyma08g07260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTRKRIQIKKIDNISSRQVTFSKRRKGLFKKAQELSTLCDADIALIVFSATSKLFEYASSSMHQVIERRDSHSAMNRLDRPSIELQIENDSNEILRKKVEDKNRELRQMNGEDLQGLTLQELHKLEEHLKRGLINVSKVKDEKLMQEISTLKRKGVELMEENQRLKQVPSLIHVHRQSSESILSNSSNLPEDGGSDTSLKLGLP*