Glyma08g07235 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g07235

Feature Type:	gene_model
Chromosome:	Gm08
Start:	5200785
stop:	5202544
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g07235

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G14110	AT	Annotation by Michelle Graham. TAIR10: Haloacid dehalogenase-like hydrolase (HAD) superfamily protein \| chr2:5952005-5953002 FORWARD LENGTH=190	SoyBase	E_val: 3.00E-16	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR17901	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR17901:SF6	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7JV35	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Magnesium-dependent phosphatase n=1 Tax=Medicago truncatula RepID=G7JV35_MEDTR	SoyBase	E_val: 2.00E-15	ISS
UniRef100_I1KL51	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KL51_SOYBN	SoyBase	E_val: 1.00E-22	ISS

Expression Patterns of Glyma08g07235

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g07235 not represented in the dataset	Glyma08g07235 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g07235

Paralog	Evidence	Comments
Glyma07g30070	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g07235 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g067900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g07235

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g07235

Limit To All Plant Sequences

>Glyma08g07235.1   sequence type=CDS   gene model=Glyma08g07235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCCATTGCTTCCAAGTCACCAACTCAGCATCAGGAAATATTTTACACCTGGAAGGACAAAACTGAGCATTTTCGGAGAATTCATTCAAAGACTGGGGTCCCCTTATAACTATATGCTCTTCTTTGACGACGACTATAATAACATTCCAGGGTGGCAATCACAGGCCTCATCAAGCATTTTGGTTACAAATGGGGTATATCTTGGAGCATTCAGAGAAGGCCTCACAAAATTTTCTCAAAACAGGAATGCATCAAAGAAGAACAAACAGAAAAGGCCCAACTAA

Predicted protein sequences of Glyma08g07235

Limit To All Plant Sequences

>Glyma08g07235.1   sequence type=predicted peptide   gene model=Glyma08g07235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPLLPSHQLSIRKYFTPGRTKLSIFGEFIQRLGSPYNYMLFFDDDYNNIPGWQSQASSSILVTNGVYLGAFREGLTKFSQNRNASKKNKQKRPN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain