| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT4G09960 | AT | Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr4:6236713-6239409 REVERSE LENGTH=216 | SoyBase | E_val: 1.00E-29 | ISS | 
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS | 
| GO:0009827 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification | SoyBase | N/A | ISS | 
| GO:0009860 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube growth | SoyBase | N/A | ISS | 
| GO:0009886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis | SoyBase | N/A | ISS | 
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS | 
| GO:0048316 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed development | SoyBase | N/A | ISS | 
| GO:0048440 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carpel development | SoyBase | N/A | ISS | 
| GO:0048441 | GO-bp | Annotation by Michelle Graham. GO Biological Process: petal development | SoyBase | N/A | ISS | 
| GO:0048443 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stamen development | SoyBase | N/A | ISS | 
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS | 
| GO:0048507 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem development | SoyBase | N/A | ISS | 
| GO:0080155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Regulation of double fertilization forming a zygote and endosperm | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS | 
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS | 
| PTHR11945 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PTHR11945:SF19 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PF00319 | PFAM | SRF-type transcription factor (DNA-binding and dimerisation domain) | JGI | ISS | |
| UniRef100_G7IS84 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: MADS-box family transcription factor n=1 Tax=Medicago truncatula RepID=G7IS84_MEDTR | SoyBase | E_val: 1.00E-29 | ISS | 
| UniRef100_I1KQW0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQW0_SOYBN | SoyBase | E_val: 1.00E-35 | ISS | 
| Glyma08g06991 not represented in the dataset | Glyma08g06991 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma08g06991.1 sequence type=CDS gene model=Glyma08g06991 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGGAGAGGAAAGATTCCCATTCGAAGAATCGAAAATTCGACGAACCGACAAGTGACTTTCTGTAAGAGAAGAAATGGGTTGCTGAAGAAAACTAGAGAACTATCCATTCTCTGTGATGCAGAAGTTGGAGTGATAGTGTTTTCCAGCACTGGCAAGCTTTATGAATATTCAAACACCAGGCAATGTTCACAGTACACGCACAACAAGCAATAA
>Glyma08g06991.1 sequence type=predicted peptide gene model=Glyma08g06991 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGRGKIPIRRIENSTNRQVTFCKRRNGLLKKTRELSILCDAEVGVIVFSSTGKLYEYSNTRQCSQYTHNKQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||