SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g06981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g06981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g06981

Feature Type:gene_model
Chromosome:Gm08
Start:4997341
stop:5009032
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G14210AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 44 | chr2:6018841-6023585 FORWARD LENGTH=234 SoyBaseE_val: 1.00E-28ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0007584GO-bp Annotation by Michelle Graham. GO Biological Process: response to nutrient SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0048589GO-bp Annotation by Michelle Graham. GO Biological Process: developmental growth SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0071249GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrate SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008134GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription factor binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF96Panther AGL21 (AGAMOUS-LIKE 21), TRANSCRIPTION FACTOR JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_G7IS85UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein AGL16-II n=1 Tax=Medicago truncatula RepID=G7IS85_MEDTR SoyBaseE_val: 1.00E-52ISS
UniRef100_UPI0002338E32UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338E32 related cluster n=1 Tax=unknown RepID=UPI0002338E32 SoyBaseE_val: 3.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g06981 not represented in the dataset

Glyma08g06981 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g065300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g06981.1   sequence type=CDS   gene model=Glyma08g06981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAACAATCATTGAGCGCTTTAACAAGCAAAACAATAATCATCATCGGCTAATGGATGCTACTTCAGCAATCAAGGGAGAAGCAGCAAGCTTGAGGCAACAACTGCAGCATTTGCAAGAAAACCACAGGCAACTGATGGGTGAAGAACTTTCTGGTTTGGGTATTAATCAGCTAAAACATCTGGAAAATCAACTACAAATGAGTTTGAATAACGTTCGCAATAAAAAGGATCACATTTTCAGTGATGAGATCAAGGAATTACAACAAAAGGGAAGCTTGATTCGTCGACAAAATGAAGAACTTCATAAGAAGATAGACCTTATCCACAATGAAAATGCAGAACTAAAGAAGGTTATTGAAGCAAGGCATAAGGAAGAAGAAAGGGCAGCACTCAAACCTCCATGTGCTATCAAAAATAGATATGATACACTTGACCCTAACAGTCTGCAACAAAGGCAGTCCCAACCCCAACCCAGTGAACCATCAGCCGAAGTGATGATTATGGGGTACTCCCTCAAATTGAAGATGTAA

>Glyma08g06981.1   sequence type=predicted peptide   gene model=Glyma08g06981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METIIERFNKQNNNHHRLMDATSAIKGEAASLRQQLQHLQENHRQLMGEELSGLGINQLKHLENQLQMSLNNVRNKKDHIFSDEIKELQQKGSLIRRQNEELHKKIDLIHNENAELKKVIEARHKEEERAALKPPCAIKNRYDTLDPNSLQQRQSQPQPSEPSAEVMIMGYSLKLKM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo