Glyma08g06760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06760

Feature Type:	gene_model
Chromosome:	Gm08
Start:	4840374
stop:	4841518
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g06760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20870	AT	Annotation by Michelle Graham. TAIR10: ZIP metal ion transporter family \| chr3:7309499-7312476 REVERSE LENGTH=276	SoyBase	E_val: 1.00E-22	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0046873	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11065	Panther	GUFA PROTEIN - RELATED	JGI		ISS
PTHR11065:SF5	Panther	INTEGRAL MEMBRANE PROTEIN	JGI		ISS
UniRef100_G7JDP0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc transporter zupT n=1 Tax=Medicago truncatula RepID=G7JDP0_MEDTR	SoyBase	E_val: 3.00E-24	ISS
UniRef100_I1KQT7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQT7_SOYBN	SoyBase	E_val: 5.00E-48	ISS

Expression Patterns of Glyma08g06760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g06760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g063100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g06760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g06760

Limit To All Plant Sequences

>Glyma08g06760.1   sequence type=CDS   gene model=Glyma08g06760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAACACAATGACATGCTTAAGGTCAGGCTGTCTATTCCCTACAAGCCTAAATCCTGAGATTCTTGAAGGTATCCTTGGATCAGTTGGTGGAGTTATGGCTTTTGTAACTCTTCATCAGATGCTGCCACTGGCTTTTAAGTACGCGGGACAAAAACAATTTGTTAAGATCATATTTTGTGGAACGACTTTCATGTCTGCAAGTACAACGCTACAAGGTCTTAACATTTAG

Predicted protein sequences of Glyma08g06760

Limit To All Plant Sequences

>Glyma08g06760.1   sequence type=predicted peptide   gene model=Glyma08g06760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNNTMTCLRSGCLFPTSLNPEILEGILGSVGGVMAFVTLHQMLPLAFKYAGQKQFVKIIFCGTTFMSASTTLQGLNI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain