Glyma08g06660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06660

Feature Type:	gene_model
Chromosome:	Gm08
Start:	4792513
stop:	4795259
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g06660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G21320	AT	Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein \| chr4:11340492-11341732 FORWARD LENGTH=286	SoyBase	E_val: 1.00E-154	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0019295	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme M biosynthetic process	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
PTHR10795	Panther	SUBTILISIN/KEXIN-RELATED SERINE PROTEASE	JGI		ISS
PTHR10795:SF3	Panther	SUBTILISIN-RELATED SERINE PROTEASE	JGI		ISS
PF02679	PFAM	(2R)-phospho-3-sulfolactate synthase (ComA)	JGI		ISS
UniRef100_B9RXV7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Furin, putative n=1 Tax=Ricinus communis RepID=B9RXV7_RICCO	SoyBase	E_val: 2.00E-152	ISS
UniRef100_UPI0001B6383F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001B6383F related cluster n=1 Tax=unknown RepID=UPI0001B6383F	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g06660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g06660

Paralog	Evidence	Comments
Glyma07g30630	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g06660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g062300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g06660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g06660

Limit To All Plant Sequences

>Glyma08g06660.1   sequence type=CDS   gene model=Glyma08g06660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCGTTCCGATGGAAGAGCTTCGAGGAGAATGAGGATCGCCCAGCCAAGCCTCGTCATTTTGGCGTCACCGAGATTCAAAGCCCCCACTGCACTCTCTTCTCCCACAACCTTCTTCAGGATATTTTTGAATCTATGGGAGACTATGTAGATGGGTTAAAGTTTTCTGGAGGTTCTCACAGCATGATGCCAAAGGCTACTATCAAGCAAATCATTGACATGGCCCATCAGCATGACGTGTATGTTAGCACGGGTGATTGGGCTGAGCACATGATTAGCAAAAGTCCATCAGGTTTCAAGGAATATGTAGAGGAATGCAAGCAGTTGGGGTTTGACACAATTGAGCTCAATGTGGGATCGCTTGAGATTCCTGAAGAAACCTTTTTGAGATTTGTCCGCTTGGTCAAAAGTGGTGGTCTCAAAGCTAAGCCTCATTTTCAAGTGAAGTTTAATGAGTCTGATATTCCCAAAGGTGGTGACAGGGCTTATGGGGCTTATATTCCCCCTGTACCTAGATCATTTGAATTGGTAGAAGATGTGAATCTCTTGATCAGAAGGGCTGAGAGATGTCTGGAAGCAGGTGCAGACATGATAATGATTGATGCTGATGATGTCAGCAAACATGCTGATAACATGCGTGCAGACATCATTGCCAAAATCATAGGGCGCCTTGGTATTGAGAAGACTATGTTTGAAGCATCAAATCAGAGAATATCGGAGTGGTTCATCAAACAATATGGTCCAAAGGTGAACCTCTTTATTGATCATTCGAACGTGGTGGATGTGGAGTGCCTCAGGGGGCGCAACTTGGGTAGAAATCTTGCTTCTTTCCTTGGTGCTTCAGATTTCCTGTTCTGA

Predicted protein sequences of Glyma08g06660

Limit To All Plant Sequences

>Glyma08g06660.1   sequence type=predicted peptide   gene model=Glyma08g06660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAFRWKSFEENEDRPAKPRHFGVTEIQSPHCTLFSHNLLQDIFESMGDYVDGLKFSGGSHSMMPKATIKQIIDMAHQHDVYVSTGDWAEHMISKSPSGFKEYVEECKQLGFDTIELNVGSLEIPEETFLRFVRLVKSGGLKAKPHFQVKFNESDIPKGGDRAYGAYIPPVPRSFELVEDVNLLIRRAERCLEAGADMIMIDADDVSKHADNMRADIIAKIIGRLGIEKTMFEASNQRISEWFIKQYGPKVNLFIDHSNVVDVECLRGRNLGRNLASFLGASDFLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain