Report for Sequence Feature Glyma08g06650
Feature Type: gene_model
Chromosome: Gm08
Start: 4788600
stop: 4791378
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g06650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G79660 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G16170.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:29976294-29976575 FORWARD LENGTH=93
SoyBase E_val: 5.00E-20 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6T4K1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4K1_SOYBN
SoyBase E_val: 3.00E-63 ISS
UniRef100_Q9S9M0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: T24D18.25 protein n=2 Tax=Arabidopsis thaliana RepID=Q9S9M0_ARATH
SoyBase E_val: 1.00E-11 ISS
Expression Patterns of Glyma08g06650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g06650
Paralog Evidence Comments
Glyma07g30640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g06650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g062200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g06650
Transcripts of Glyma08g06650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g06650.2 sequence type=transcript gene model=Glyma08g06650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GTTTATCGTTATGGTTACGGATGGTTCCTCTTCTTCCTCTCACATGGCATGACACCAGTAATAATAACACATTCCACTTTCCCATCTCTGGTTTTTACATTACAATACAACCTTAACGCTCTTGTTCACGAAACACGCGCTTTTTCACAACCTTCGAAGTCTTTTTCGCAACCTTCGAAGTCAAAAGATTCAGGCATTCTAGTCCCGAGTAAGTCATTGTAGAAGCCATGGTTCTCGACTCCATTTTGTCGTCTTCTCCTTGTCTGAAGTCACCATCTTTCAGTAGGCAGTTTGCAAGGCATGAACTGGGAAGTTGGTCAACACTCGTCAAGAGACACTGCTTCCTCTTATCTGCTCTTGCTCTACTAACTGTCCTCTGTACCATTTATCTATATTTTGCAGTTACATTCGCAGCCAATGACTCCTGCTCTGGGTTGAGTGGATCTCTGAGAGATTCCTGTCATATGGAGCATGTTATGGATTCTGAAGCCAAGAGTAAACTGAAAGGTCTGAGACATTTATGATTTCCAATTCAAGTTGTGCCGGAGAGTTTTTTTATCTTTTCCTTTAGTATAATATGTACTATTTATCCATACTGTTTATCTTAGTATTTGTGAGCCAAAATGTACAATGTATGTAGAAAGCAATTTCTTGAATGCTCATTTGGGGGCTGCTTTCTGGGGTCTAATATAAGATCAGTGAGCATCCTGTTGATGGTTAATTCAAAACTTCAGATTTCTCATTTGTGAAATACGTTTGGTTCATTTTTAAATATGGACCTTTTCATGAAGGATCATTTTCGTTGTTGCAAACCAGA
Coding sequences of Glyma08g06650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g06650.1 sequence type=CDS gene model=Glyma08g06650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTCTCGACTCCATTTTGTCGTCTTCTCCTTGTCTGAAGTCACCATCTTTCAGTAGGCAGTTTGCAAGGCATGAACTGGGAAGTTGGTCAACACTCGTCAAGAGACACTGCTTCCTCTTATCTGCTCTTGCTCTACTAACTGTCCTCTGTACCATTTATCTATATTTTGCAGTTACATTCGCAGCCAATGACTCCTGCTCTGGGTTGAGTGGATCTCTGAGAGATTCCTGTCATATGGAGCATGTTATGGATTCTGAAGCCAAGAGTAAACTGAAAGGTCTGAGACATTTATGA
>Glyma08g06650.2 sequence type=CDS gene model=Glyma08g06650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTCTCGACTCCATTTTGTCGTCTTCTCCTTGTCTGAAGTCACCATCTTTCAGTAGGCAGTTTGCAAGGCATGAACTGGGAAGTTGGTCAACACTCGTCAAGAGACACTGCTTCCTCTTATCTGCTCTTGCTCTACTAACTGTCCTCTGTACCATTTATCTATATTTTGCAGTTACATTCGCAGCCAATGACTCCTGCTCTGGGTTGAGTGGATCTCTGAGAGATTCCTGTCATATGGAGCATGTTATGGATTCTGAAGCCAAGAGTAAACTGAAAGGTCTGAGACATTTATGA
Predicted protein sequences of Glyma08g06650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g06650.1 sequence type=predicted peptide gene model=Glyma08g06650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVLDSILSSSPCLKSPSFSRQFARHELGSWSTLVKRHCFLLSALALLTVLCTIYLYFAVTFAANDSCSGLSGSLRDSCHMEHVMDSEAKSKLKGLRHL*
>Glyma08g06650.2 sequence type=predicted peptide gene model=Glyma08g06650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVLDSILSSSPCLKSPSFSRQFARHELGSWSTLVKRHCFLLSALALLTVLCTIYLYFAVTFAANDSCSGLSGSLRDSCHMEHVMDSEAKSKLKGLRHL*