SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g06340

Feature Type:gene_model
Chromosome:Gm08
Start:4493970
stop:4495511
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61340AT Annotation by Michelle Graham. TAIR10: F-box family protein | chr1:22628526-22629741 FORWARD LENGTH=185 SoyBaseE_val: 1.00E-25ISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009961GO-bp Annotation by Michelle Graham. GO Biological Process: response to 1-Aminocyclopropane-1-carboxylic Acid SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B9H220UniRef Annotation by Michelle Graham. Most informative UniRef hit: F-box family protein n=1 Tax=Populus trichocarpa RepID=B9H220_POPTR SoyBaseE_val: 2.00E-34ISS
UniRef100_I1KQQ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQQ1_SOYBN SoyBaseE_val: 2.00E-108ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g30950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g058900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g06340.1   sequence type=CDS   gene model=Glyma08g06340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTTAGGGTTTGAGGGTTATAGTTATACAACAACACTTGGAAGGAAAAGGGTTGTGTTATTACACAGTGAAGCTTCTTCTCTCAACTCCAATTCACCGGTGAATTCATTGAAGAGAATGTGTAGCAAGAAATTCACATTTGACTCTGAAAGGTCTCGCCTTGAGGCCCTTCCTCTTGATGTTCTGATAAGGGTGTTGTGTGGTGTCGATCATGAAGATTTGAAGCAACTTGTTCGAGTCTCAAAAACTGTTAGAGAAGCGGCTGAGGTTGCTAGGAGGATGCATTTTGAGTATAGCACTCCAAAGAAGAAAAATTTTGCTATTCCTAAACCGTTTGATATAGAGGGTGCTGGTGGGTTTGAGGAAATTGATACTCCAAAAGCCCCATCGAAGAAAGCTAAGTCAAAGCTGATTGGTAAGAATCTAGCAAGCATCTCAGTGGCATTGTTTGCTTCCCCTAATTAG

>Glyma08g06340.1   sequence type=predicted peptide   gene model=Glyma08g06340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALGFEGYSYTTTLGRKRVVLLHSEASSLNSNSPVNSLKRMCSKKFTFDSERSRLEALPLDVLIRVLCGVDHEDLKQLVRVSKTVREAAEVARRMHFEYSTPKKKNFAIPKPFDIEGAGGFEEIDTPKAPSKKAKSKLIGKNLASISVALFASPN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo