Glyma08g06330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06330

Feature Type:	gene_model
Chromosome:	Gm08
Start:	4487558
stop:	4489934
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g06330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G21470	AT	Annotation by Michelle Graham. TAIR10: riboflavin kinase/FMN hydrolase \| chr4:11431284-11433197 FORWARD LENGTH=379	SoyBase	E_val: 9.00E-116	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009231	GO-bp	Annotation by Michelle Graham. GO Biological Process: riboflavin biosynthetic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0003919	GO-mf	Annotation by Michelle Graham. GO Molecular Function: FMN adenylyltransferase activity	SoyBase	N/A	ISS
GO:0008531	GO-mf	Annotation by Michelle Graham. GO Molecular Function: riboflavin kinase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG3110	KOG	Riboflavin kinase	JGI		ISS
PTHR22749	Panther	RIBOFLAVIN KINASE/FMN ADENYLYLTRANSFERASE	JGI		ISS
PF01687	PFAM	Riboflavin kinase	JGI		ISS
UniRef100_I1KQQ0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KQQ0_SOYBN	SoyBase	E_val: 3.00E-133	ISS
UniRef100_Q2HU01	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Riboflavin kinase / FAD synthetase n=1 Tax=Medicago truncatula RepID=Q2HU01_MEDTR	SoyBase	E_val: 2.00E-120	ISS

Expression Patterns of Glyma08g06330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g06330

Paralog	Evidence	Comments
Glyma07g30970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g06330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g058800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g06330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g06330

Limit To All Plant Sequences

>Glyma08g06330.1   sequence type=CDS   gene model=Glyma08g06330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTAGTTGCTGTACCATCACTTCCAAAACAGTTGCATCTCTATACTGCAGCAGATGAGGTGATCAATTCCCTACTTGATTTGCGACTTGAAAAGTGGGGTCTGCCTCCATTTGAAGATTGGGTGGAGGGAACTTTGCCCCTAGATCCTTGGTATATTGTTGGTCCTGTCGTTAAGGGATTTGGTCGTGACTCGAAGGTACTTGGGATCCCTACAGCAAATTTATCAACAAAGGGCTATTCAGATCTCCTTTCAGAGCATCCTGCGGGAGTTTATTTTGATTGGGCTGGATTGTCAGCCAGAGGTGTTTTTAAAATGGTGATGAGCATTGGTTGGAATCCTTATTTCAACAACAAAGAGAAGACTATAGAACCATGGTTACTTCATGACTTCAACGAAGATTTCTATGGAGAAGAACTGCGGCTTGTTATAGTTGGTTACATACGTCCCGAGGCCAATTTTCCATCCCTTGAAAGCTTGGTAGCTAAAATTCATGAAGATCGAAGAGTTGCTGAGAGGGCCCTTGATCTTCCCTTGTATTCAAGTTTTAAGAATGATTCGTATTTGAGAAGCTCTTAG

Predicted protein sequences of Glyma08g06330

Limit To All Plant Sequences

>Glyma08g06330.1   sequence type=predicted peptide   gene model=Glyma08g06330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVVAVPSLPKQLHLYTAADEVINSLLDLRLEKWGLPPFEDWVEGTLPLDPWYIVGPVVKGFGRDSKVLGIPTANLSTKGYSDLLSEHPAGVYFDWAGLSARGVFKMVMSIGWNPYFNNKEKTIEPWLLHDFNEDFYGEELRLVIVGYIRPEANFPSLESLVAKIHEDRRVAERALDLPLYSSFKNDSYLRSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain