SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06200

Feature Type:gene_model
Chromosome:Gm08
Start:4412868
stop:4413767
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g06200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G25720AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 38 Blast hits to 38 proteins in 18 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 38; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:10955664-10956017 REVERSE LENGTH=117 SoyBaseE_val: 8.00E-31ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF08555PFAM Eukaryotic family of unknown function (DUF1754) JGI ISS
UniRef100_I1KQN7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQN7_SOYBN SoyBaseE_val: 2.00E-86ISS
UniRef100_Q01KG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: OSIGBa0158F05.10 protein n=4 Tax=Oryza sativa RepID=Q01KG0_ORYSA SoyBaseE_val: 8.00E-20ISS

Expression Patterns of Glyma08g06200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g06200 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g057500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g06200
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g06200
>Glyma08g06200.2   sequence type=CDS   gene model=Glyma08g06200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAAAGCCCACAAATATATAATTGAAATAGAAAAGACGGTGATTGTATTGTTTGGGGCCGGGTCGACTCGAGGAAGAGAACTGAGAAGCAGAGCAGCGGTGTGGTTGATTGGGATGTCGGATCCGTACGAGCGGGTGAAAGGAGGAAGATTAGCATTCAAAGGAGGAATCCTTGCCAGTCGCTCCAAATCCATTGACAAAAAGGGGAAGAAGAAGAAGAAGAACAAGGGCAAGGACAACGACAACAACCCTAACCCTAACCCTAACCCTGAAGAACAGGAACTGGAACAGGAACAGAAACAGGAGCAGGAAGAAACCCCCCTCCTCGAGGACGAGGGCGAGGGATCTGAATACACCATCGATGCGGCCAAGCGTATGAAGTACGAACAACTGTTCCCTGTCGAAGCCAAGAAGTTCGGTTATCAACCCAAAACCAACTTCAAGTCAGTTGAGGATGCCCTCGATGATCGCGTCAAGAAGAAGGCTGATCGCTATTGTAAATAG
Predicted protein sequences of Glyma08g06200
>Glyma08g06200.2   sequence type=predicted peptide   gene model=Glyma08g06200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKAHKYIIEIEKTVIVLFGAGSTRGRELRSRAAVWLIGMSDPYERVKGGRLAFKGGILASRSKSIDKKGKKKKKNKGKDNDNNPNPNPNPEEQELEQEQKQEQEETPLLEDEGEGSEYTIDAAKRMKYEQLFPVEAKKFGYQPKTNFKSVEDALDDRVKKKADRYCK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo