SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06120

Feature Type:gene_model
Chromosome:Gm08
Start:4335489
stop:4339674
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g06120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24660AT Annotation by Michelle Graham. TAIR10: homeobox protein 22 | chr4:12724851-12725513 REVERSE LENGTH=220 SoyBaseE_val: 8.00E-38ISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0048608GO-bp Annotation by Michelle Graham. GO Biological Process: reproductive structure development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04770PFAM ZF-HD protein dimerisation region JGI ISS
UniRef100_I1KQN0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQN0_SOYBN SoyBaseE_val: 2.00E-108ISS
UniRef100_Q5IR72UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger homeodomain protein SZF-HD1 n=2 Tax=Glycine max RepID=Q5IR72_SOYBN SoyBaseE_val: 4.00E-62ISS

Expression Patterns of Glyma08g06120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g06120
ParalogEvidenceComments
Glyma05g33600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g06120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g056700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g06120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g06120
>Glyma08g06120.1   sequence type=CDS   gene model=Glyma08g06120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGAGGATCGGGTGGTGGCGAGAGAGAGAAGTGGAACAGTGTAAGTGTATACAGAGAGTGCTTGAGAAACCATGCAGCCAGCCTCGGAAGCTACGCCACGGACGGGTGCGGCGAGTTCACGGTGGACGGCGCGGGGGGACTACAATGCGCGGCGTGCGGCTGCCACCGCAACTTCCACCGGAAAGTGAAGTACCCGGTGGCGGAGCATGAGGAGTATGGAGGCAAGAAGCGGTTCAGGTCCAAGTTCACGGCAGATCAGAAGGAGAAGATGCTGGGGTTTGCGGAGAAGCTTGGTTGGAAGCTTCAGAGGAAGGATCTGAATGATGAGATAGAGAGGTTTTGCCGGAGCGTTGGGGTTAGTAGGCAAGTCTTCAAAGTTTGGATGCATAACCATAAGAACTCTTCCTCCTCCTCCTCCTCTACCCCCGCCAATGTCTCCTCCCTCACCCAATGA
Predicted protein sequences of Glyma08g06120
>Glyma08g06120.1   sequence type=predicted peptide   gene model=Glyma08g06120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGSGGGEREKWNSVSVYRECLRNHAASLGSYATDGCGEFTVDGAGGLQCAACGCHRNFHRKVKYPVAEHEEYGGKKRFRSKFTADQKEKMLGFAEKLGWKLQRKDLNDEIERFCRSVGVSRQVFKVWMHNHKNSSSSSSSTPANVSSLTQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo