SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g06081

Feature Type:gene_model
Chromosome:Gm08
Start:4321880
stop:4322882
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g06081
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01890AT Annotation by Michelle Graham. TAIR10: purple acid phosphatase 8 | chr2:396985-399168 REVERSE LENGTH=335 SoyBaseE_val: 3.00E-19ISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0016311GO-bp Annotation by Michelle Graham. GO Biological Process: dephosphorylation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003993GO-mf Annotation by Michelle Graham. GO Molecular Function: acid phosphatase activity SoyBaseN/AISS
GO:0004722GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
UniRef100_G7LE87UniRef Annotation by Michelle Graham. Most informative UniRef hit: Purple acid phosphatase n=1 Tax=Medicago truncatula RepID=G7LE87_MEDTR SoyBaseE_val: 1.00E-28ISS
UniRef100_UPI0002338260UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338260 related cluster n=1 Tax=unknown RepID=UPI0002338260 SoyBaseE_val: 7.00E-43ISS

Expression Patterns of Glyma08g06081
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g06081 not represented in the dataset
Glyma08g06081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g06081
ParalogEvidenceComments
Glyma05g33640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g06081 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g056300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g06081
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g06081
>Glyma08g06081.1   sequence type=CDS   gene model=Glyma08g06081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCACTTAGCCTTGTGGTCATTGGAGACCGGGGAAGGAAAGGAACATACAACCAATCTCAAGTTGCCACTCAGCCAAATCCAGTTCTTAACCAGTGGTGGAGGTTCAAAGGCATGGAAAGGAGACATGGATAAAGATAAGACAGATGGGATCAAGTTTTATTATGATGGACAAGGATTTATGTCCGCGGAGCTGGAAGAAACCAATGTCAAAGTTGTTTATTATGATATTTTGGGGAAAGTTTTGCATGTTGTGAATCTGCCCAAGGGGTTAGGTACTTCTGTCTCTGCCATATAG
Predicted protein sequences of Glyma08g06081
>Glyma08g06081.1   sequence type=predicted peptide   gene model=Glyma08g06081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHLALWSLETGEGKEHTTNLKLPLSQIQFLTSGGGSKAWKGDMDKDKTDGIKFYYDGQGFMSAELEETNVKVVYYDILGKVLHVVNLPKGLGTSVSAI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo