SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g05911

Feature Type:gene_model
Chromosome:Gm08
Start:4223469
stop:4224157
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g05911
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18000AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr3:6154578-6157331 FORWARD LENGTH=491 SoyBaseE_val: 2.00E-43ISS
GO:0006656GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylcholine biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010183GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube guidance SoyBaseN/AISS
GO:0042425GO-bp Annotation by Michelle Graham. GO Biological Process: choline biosynthetic process SoyBaseN/AISS
GO:0048528GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic root development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000234GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoethanolamine N-methyltransferase activity SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR10108Panther METHYLTRANSFERASE JGI ISS
PTHR10108:SF328Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7KQ78UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoethanolamine N-methyltransferase n=1 Tax=Medicago truncatula RepID=G7KQ78_MEDTR SoyBaseE_val: 6.00E-52ISS
UniRef100_I1K5B7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5B7_SOYBN SoyBaseE_val: 6.00E-67ISS

Expression Patterns of Glyma08g05911
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g05911 not represented in the dataset
Glyma08g05911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g05911 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g05911
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g05911
>Glyma08g05911.1   sequence type=CDS   gene model=Glyma08g05911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGTTGAAGCCTGGAGGAAAAATTCTAATTACAGATTACTGCAAAAGTGCTGGAAGTCCATCTTTAGAATTTGATGAGTACATTAAAAAAGGAGGATATTATCCCCATGACATTAAAGCGTATAGGCAGATGCTCGAGGATGCTGGATTTGATGATGTCATTGCTGAGGATCGAACTGATCGGGTTTGTCTTTCGTTGAAACATACACTACAGCAGGAGTTAGATGCCCTTGAGAACAAGAAGGGCGATTTTATTCGTGACTTCAGCGAAGAAGACTACAATGAGATTGTGGAAAGATGGAAGGCAAAGCAGACCAGGGGTGCATCTAGAGAGCAGATGTGGGGTTTGTTCATTGCCAAGAAAAATTGA
Predicted protein sequences of Glyma08g05911
>Glyma08g05911.1   sequence type=predicted peptide   gene model=Glyma08g05911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWLKPGGKILITDYCKSAGSPSLEFDEYIKKGGYYPHDIKAYRQMLEDAGFDDVIAEDRTDRVCLSLKHTLQQELDALENKKGDFIRDFSEEDYNEIVERWKAKQTRGASREQMWGLFIAKKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo