Glyma08g05820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g05820

Feature Type:	gene_model
Chromosome:	Gm08
Start:	4143026
stop:	4144546
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g05820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18250	AT	Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein \| chr1:6277024-6278005 REVERSE LENGTH=244	SoyBase	E_val: 1.00E-137	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0051322	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaphase	SoyBase	N/A	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
PF00314	PFAM	Thaumatin family	JGI		ISS
UniRef100_B9T3K3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein P21, putative n=1 Tax=Ricinus communis RepID=B9T3K3_RICCO	SoyBase	E_val: 5.00E-144	ISS
UniRef100_I1KQK1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KQK1_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g05820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g05820

Paralog	Evidence	Comments
Glyma05g33860	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g05820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g053600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g05820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g05820

Limit To All Plant Sequences

>Glyma08g05820.1   sequence type=CDS   gene model=Glyma08g05820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGATGGGCTCAATGCTGCTCAGTCTCAGACCCTTTCTCACCACCATCTTCTTTCTCACACTCACAGTGCTCAAGGTTTCAGCATCATCCTCAGTGATTTTCTACAACAAGTGCCAGCACCCAGTGTGGCCCGGGATCCAGCCCAGCGCAGGAAAGCCCGTTCTGGCCCGCGGAGGCTTCAAGCTCGCCCCAAACCGGGCCTACTCCCTCCAGCTCCCCGCTCTATGGTCCGGGCGCTTCTGGGGCCGCCACGGCTGTTCCTTCGACGCCGGCGGCCGGGGGCGCTGCGCCACCGGGGACTGCGGCGGGTCCCTGTTCTGCAACGGCATCGGCGGAAGCCCACCGGCGACCCTGGCGGAGTTCACCCTGGGCAACGAGCAGGACTTCTACGACGTGAGCCTGGTGGACGGGTACAACCTACCCATCTCCATCACCCCCTTCAAGGGATCCGGAAAATGCAGCTACGCCGGGTGCGTGAGCGACCTCAACACCATGTGCCCCGTTGGCCTCCAAGTGCGCTCACGCGACAACAAGCGCGTGGTGGCCTGCAAGAGCGCTTGCTCCGCTTTCAACTCCCCCAGGTACTGCTGCACGGGCTCCTATGGAAGCCCACAGGCCTGCAAGCCCACCGTCTATTCCAAGATCTTCAAGACCGCATGCCCCAAGGCCTACTCCTATGCCTATGATGACCCCACCAGCATCGCTACTTGCACCAAAGCTAACTATTTGGTCACCTTCTGCCCCCATCGCCGCTAG

Predicted protein sequences of Glyma08g05820

Limit To All Plant Sequences

>Glyma08g05820.1   sequence type=predicted peptide   gene model=Glyma08g05820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMMGSMLLSLRPFLTTIFFLTLTVLKVSASSSVIFYNKCQHPVWPGIQPSAGKPVLARGGFKLAPNRAYSLQLPALWSGRFWGRHGCSFDAGGRGRCATGDCGGSLFCNGIGGSPPATLAEFTLGNEQDFYDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAFNSPRYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYLVTFCPHRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain