SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g05521

Feature Type:gene_model
Chromosome:Gm08
Start:3956222
stop:3956511
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g05521
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00430AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein G | chrC:49257-49934 REVERSE LENGTH=225 SoyBaseE_val: 1.00E-29ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0045333GO-bp Annotation by Michelle Graham. GO Biological Process: cellular respiration SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
GO:0016651GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0048038GO-mf Annotation by Michelle Graham. GO Molecular Function: quinone binding SoyBaseN/AISS
GO:0051539GO-mf Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding SoyBaseN/AISS
PTHR11995Panther NADH DEHYDROGENASE JGI ISS
PTHR11995:SF5Panther NADH DEHYDROGENASE JGI ISS
PF01058PFAM NADH ubiquinone oxidoreductase, 20 Kd subunit JGI ISS
UniRef100_P31175UniRef Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit K, chloroplastic n=1 Tax=Glycine max RepID=NDHK_SOYBN SoyBaseE_val: 1.00E-33ISS
UniRef100_P31175UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit K, chloroplastic n=1 Tax=Glycine max RepID=NDHK_SOYBN SoyBaseE_val: 1.00E-33ISS

Expression Patterns of Glyma08g05521
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g05521 not represented in the dataset
Glyma08g05521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g05521 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g050600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g05521
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g05521
>Glyma08g05521.1   sequence type=CDS   gene model=Glyma08g05521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAATTACAGGGGGATGTTTAGTACCGATTCTTATAGTACTGTTCGGGGCGTGGATAAACTAATCCCAGTGGATGTCTATTTGCCGGGCTGTCCACCTAAACCGGAGGCTATTATAGATGCTATAACAAAACTTCGTAAGAAAATATCTCGAGAAATATATGAAAATCAAATGAGTTCTCAACGAGAGAAATCTTTTTATTAA
Predicted protein sequences of Glyma08g05521
>Glyma08g05521.1   sequence type=predicted peptide   gene model=Glyma08g05521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYNYRGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAITKLRKKISREIYENQMSSQREKSFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo