|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00430 | AT | Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein G | chrC:49257-49934 REVERSE LENGTH=225 | SoyBase | E_val: 1.00E-29 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0045333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular respiration | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0045271 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I | SoyBase | N/A | ISS |
| GO:0008137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
| GO:0016651 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H | SoyBase | N/A | ISS |
| GO:0048038 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: quinone binding | SoyBase | N/A | ISS |
| GO:0051539 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding | SoyBase | N/A | ISS |
| PTHR11995 | Panther | NADH DEHYDROGENASE | JGI | ISS | |
| PTHR11995:SF5 | Panther | NADH DEHYDROGENASE | JGI | ISS | |
| PF01058 | PFAM | NADH ubiquinone oxidoreductase, 20 Kd subunit | JGI | ISS | |
| UniRef100_P31175 | UniRef | Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit K, chloroplastic n=1 Tax=Glycine max RepID=NDHK_SOYBN | SoyBase | E_val: 1.00E-33 | ISS |
| UniRef100_P31175 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit K, chloroplastic n=1 Tax=Glycine max RepID=NDHK_SOYBN | SoyBase | E_val: 1.00E-33 | ISS |
|
Glyma08g05521 not represented in the dataset |
Glyma08g05521 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g050600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g05521.1 sequence type=CDS gene model=Glyma08g05521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTACAATTACAGGGGGATGTTTAGTACCGATTCTTATAGTACTGTTCGGGGCGTGGATAAACTAATCCCAGTGGATGTCTATTTGCCGGGCTGTCCACCTAAACCGGAGGCTATTATAGATGCTATAACAAAACTTCGTAAGAAAATATCTCGAGAAATATATGAAAATCAAATGAGTTCTCAACGAGAGAAATCTTTTTATTAA
>Glyma08g05521.1 sequence type=predicted peptide gene model=Glyma08g05521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MYNYRGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAIIDAITKLRKKISREIYENQMSSQREKSFY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||