Report for Sequence Feature Glyma08g05180
Feature Type: gene_model
Chromosome: Gm08
Start: 3674131
stop: 3676322
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g05180
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G12400 AT
Annotation by Michelle Graham. TAIR10: Nucleotide excision repair, TFIIH, subunit TTDA | chr1:4222296-4222603 FORWARD LENGTH=71
SoyBase E_val: 6.00E-34 ISS
GO:0006289 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleotide-excision repair
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
KOG3451
KOG
Uncharacterized conserved protein
JGI ISS
PF06331 PFAM
Transcription factor TFIIH complex subunit Tfb5
JGI ISS
UniRef100_G7K0H7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: General transcription factor IIH subunit n=1 Tax=Medicago truncatula RepID=G7K0H7_MEDTR
SoyBase E_val: 2.00E-42 ISS
UniRef100_I1KQC7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KQC7_SOYBN
SoyBase E_val: 2.00E-44 ISS
Expression Patterns of Glyma08g05180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g05180
Paralog Evidence Comments
Glyma05g34510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g05180 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g047000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g05180
Coding sequences of Glyma08g05180
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g05180.1 sequence type=CDS gene model=Glyma08g05180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTCAATGCCACTAAAGGAGTCTTTATTTCCTGTGACATACCTATGGCACAATATATCATCAACATGAATGCTTCATTGCCTGCATCTGACAAGTTCATTATACATATATTGGATAATACACATATGTTTGTCCAACCTCATGTTGAGCAAATGATACGAAGTCGAATTGCAAAGTTCAGAGAGGACAATACATATGTCAAGCCTAATTGA
Predicted protein sequences of Glyma08g05180
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g05180.1 sequence type=predicted peptide gene model=Glyma08g05180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVNATKGVFISCDIPMAQYIINMNASLPASDKFIIHILDNTHMFVQPHVEQMIRSRIAKFREDNTYVKPN*