SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g04815

Feature Type:gene_model
Chromosome:Gm08
Start:3416040
stop:3418052
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g04815
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24830AT Annotation by Michelle Graham. TAIR10: arginosuccinate synthase family | chr4:12793085-12795857 REVERSE LENGTH=494 SoyBaseE_val: 4.00E-156ISS
GO:0006526GO-bp Annotation by Michelle Graham. GO Biological Process: arginine biosynthetic process SoyBaseN/AISS
GO:0006567GO-bp Annotation by Michelle Graham. GO Biological Process: threonine catabolic process SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0004055GO-mf Annotation by Michelle Graham. GO Molecular Function: argininosuccinate synthase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11587Panther ARGININOSUCCINATE SYNTHASE JGI ISS
PF00764PFAM Arginosuccinate synthase JGI ISS
UniRef100_G7JWM6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Argininosuccinate synthase n=1 Tax=Medicago truncatula RepID=G7JWM6_MEDTR SoyBaseE_val: 2.00E-162ISS
UniRef100_UPI00023389EAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023389EA related cluster n=1 Tax=unknown RepID=UPI00023389EA SoyBaseE_val: 3.00E-180ISS

Expression Patterns of Glyma08g04815
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g04815 not represented in the dataset
Glyma08g04815 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g04815
ParalogEvidenceComments
Glyma05g34900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g04815 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g043400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g04815
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g04815
>Glyma08g04815.1   sequence type=CDS   gene model=Glyma08g04815   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCGATGGTTGATGCTGCCGAAGAAGTTGGAGCTGATGCTGTCTCCCATGGGTGTACAGGGAAAGGAAATGATCAGGTTCGATTTGAACTTACTTTCTTTGCTCTGAACCCCAAGCTAAATGTTGTGGCTCCATGGAGGGAGTGGGATATTACAGGTAGAGAACTTGCTATCGAGTATGCTAAAAAGCATAATATATCCGTTCCTGTGACAAAGAAATCCATATATAGCAGGGATAGGAATCTTTGGCACCTAAGCCATGAGAGTGATATTTTGGAAGACCCAGCTAATGAGCCTAAAAAGGACATGTACATGATGCCTGTAGATCCTGAGGATGCTCCTGATCAAGCAGAATATGTGGAAATTGAGATAGAGTGGGGCCTTCCTGTTTCAGTCAATGGGAAGAGGCTTTGGCCAGCATATTTACTTACTGAGCTCAATGAGATTGGTGGAAGGCATGGAATTGGCCGGATCGACATGGTTGAGAATCGGCTTGTGGGTATGAAGAGCCGTGGAGTTTATGATACTCCAGGTGGAACCATCCTGTTTGCTGCAGCACGCGAGCTGGAGTTTTTGACACTTGATCGAGAAACAATACAAGTCAAAGATTCATTAGCCCTTAAATATGCAGAGTTAGTATATGCTGGCAGATGGTTTGATCCGCTTCGGGAGTCCATGGATGCCTTAATGCAGAAGATCACAGAGACAACAACAGGTTCGGTGACTTTGAAATTGTACTAA
Predicted protein sequences of Glyma08g04815
>Glyma08g04815.1   sequence type=predicted peptide   gene model=Glyma08g04815   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AMVDAAEEVGADAVSHGCTGKGNDQVRFELTFFALNPKLNVVAPWREWDITGRELAIEYAKKHNISVPVTKKSIYSRDRNLWHLSHESDILEDPANEPKKDMYMMPVDPEDAPDQAEYVEIEIEWGLPVSVNGKRLWPAYLLTELNEIGGRHGIGRIDMVENRLVGMKSRGVYDTPGGTILFAAARELEFLTLDRETIQVKDSLALKYAELVYAGRWFDPLRESMDALMQKITETTTGSVTLKLY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo