Report for Sequence Feature Glyma08g04710
Feature Type: gene_model
Chromosome: Gm08
Start: 3352305
stop: 3356948
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g04710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G23260 AT
Annotation by Michelle Graham. TAIR10: MMS ZWEI homologue 1 | chr1:8257209-8258573 REVERSE LENGTH=158
SoyBase E_val: 2.00E-91 ISS
GO:0006301 GO-bp
Annotation by Michelle Graham. GO Biological Process: postreplication repair
SoyBase N/A ISS
GO:0006623 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0031372 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: UBC13-MMS2 complex
SoyBase N/A ISS
GO:0004842 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0016881 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity
SoyBase N/A ISS
KOG0896
KOG
Ubiquitin-conjugating enzyme E2
JGI ISS
PTHR24067 Panther
UBIQUITIN-CONJUGATING ENZYME E2
JGI ISS
PTHR24067:SF8 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00179 PFAM
Ubiquitin-conjugating enzyme
JGI ISS
UniRef100_C6TLV8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLV8_SOYBN
SoyBase E_val: 5.00E-114 ISS
UniRef100_Q45W76 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating enzyme 2 n=1 Tax=Arachis hypogaea RepID=Q45W76_ARAHY
SoyBase E_val: 5.00E-108 ISS
Expression Patterns of Glyma08g04710
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma08g04710
Paralog Evidence Comments
Glyma05g35000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g04710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g042500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g04710
Coding sequences of Glyma08g04710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g04710.1 sequence type=CDS gene model=Glyma08g04710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTTCTGAAGGTTCCACTGTCGTCGTTCCTAGGAATTTCAGATTATTGGAAGAGCTTGAGAGAGGTGAGAAGGGAATTGGAGATGGAACTGTTAGCTACGGAATGGATGATGCTGATGATATCTACATGCAGTCCTGGACTGGGACTATTATTGGCCCCCCTGGTGGCGTTCATGAAGGGCGTATCTACCAGCTGAAATTATTTTGTGGCAAGGATTATCCAGACAATCCACCAACTGTTAGATTTCAGACTAGGATTAACATGACTTGTGTCAACCAAGAAACTGGAGTGGTTGAGCCACATTTGTTTCCTATGCTTGCTAATTGGCAAAGAGAGTGTACAATGGAAGACATTTTGATGCAATTGAAGAAAGAAATGATGTCTCCACAAAATCGGAAGCTAGCTCAGCCACCTGAAGGCAATGAAGATGGCAGGATTGATCAAAAGGGGCTGGTGCTGAGATGTTGTATCATGTAA
Predicted protein sequences of Glyma08g04710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g04710.1 sequence type=predicted peptide gene model=Glyma08g04710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGSEGSTVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMQSWTGTIIGPPGGVHEGRIYQLKLFCGKDYPDNPPTVRFQTRINMTCVNQETGVVEPHLFPMLANWQRECTMEDILMQLKKEMMSPQNRKLAQPPEGNEDGRIDQKGLVLRCCIM*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
