Glyma08g04550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g04550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g04550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g04550

Feature Type:	gene_model
Chromosome:	Gm08
Start:	3234391
stop:	3238719
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g04550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46310	AT	Annotation by Michelle Graham. TAIR10: cytokinin response factor 5 \| chr2:19011614-19012498 FORWARD LENGTH=294	SoyBase	E_val: 5.00E-16	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0042991	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048825	GO-bp	Annotation by Michelle Graham. GO Biological Process: cotyledon development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_G7JX98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7JX98_MEDTR	SoyBase	E_val: 2.00E-16	ISS
UniRef100_I1KQ50	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQ50_SOYBN	SoyBase	E_val: 5.00E-115	ISS

Expression Patterns of Glyma08g04550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g04550 not represented in the dataset	Glyma08g04550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g04550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g040900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g04550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g04550

Limit To All Plant Sequences

>Glyma08g04550.2   sequence type=CDS   gene model=Glyma08g04550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGCTCACAAAGACAATCTGCGACAAAACAAGGATCGCCGTCGTCTCAGAAGGGAAATGAAAAGGCAACATCATTTGGTGAGTGCTCTTGGAAGACACTCCGAATAACATATACCGACCCAGATGCTACAGATTCTTCTAGTGACGAAGAAAATGACAAAGTATCAAATGGTGGTCCCAAAAGACGATTCATAGACATAACGAATCCAAATTGGAAGGATCCAAACTGCAAACTTTCCATCAGAAAAGGAAAACGCATATGTTCCAGCAAGTATCTAGGTGTTAGACGTCGACCATGGGGGAAATATGCAGCAGAGATTCGTGACCCGCGTCAAAAGAATTGTCGTAAGCGCTTGTGGCTTGGTTCATATGATACTGAGATAGAGGCTGCAATGACTTTTAATGTAAAAAGGCAAGAGTTTGAGAGAGAAATGGCTCTAGAAAGAGGAGATAATGCATCAGTGCATTCGGAGGGTACTGCCAAAGAAGATTAA

Predicted protein sequences of Glyma08g04550

Limit To All Plant Sequences

>Glyma08g04550.2   sequence type=predicted peptide   gene model=Glyma08g04550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSQRQSATKQGSPSSQKGNEKATSFGECSWKTLRITYTDPDATDSSSDEENDKVSNGGPKRRFIDITNPNWKDPNCKLSIRKGKRICSSKYLGVRRRPWGKYAAEIRDPRQKNCRKRLWLGSYDTEIEAAMTFNVKRQEFEREMALERGDNASVHSEGTAKED*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain