SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g03980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g03980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g03980

Feature Type:gene_model
Chromosome:Gm08
Start:2816264
stop:2820333
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51130AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:20781896-20783901 FORWARD LENGTH=318 SoyBaseE_val: 5.00E-122ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006479GO-bp Annotation by Michelle Graham. GO Biological Process: protein methylation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
GO:0008276GO-mf Annotation by Michelle Graham. GO Molecular Function: protein methyltransferase activity SoyBaseN/AISS
KOG2899 KOG Predicted methyltransferase JGI ISS
PTHR12315Panther BICOID-INTERACTING PROTEIN RELATED JGI ISS
PF02390PFAM Putative methyltransferase JGI ISS
PF06859PFAM Bicoid-interacting protein 3 (Bin3) JGI ISS
UniRef100_G7L862UniRef Annotation by Michelle Graham. Most informative UniRef hit: 7SK snRNA methylphosphate capping enzyme n=1 Tax=Medicago truncatula RepID=G7L862_MEDTR SoyBaseE_val: 1.00E-155ISS
UniRef100_I1KPY6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPY6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g03980 not represented in the dataset

Glyma08g03980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g035500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g03980.1   sequence type=CDS   gene model=Glyma08g03980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGCCAGAAGCAGAACAGTAAAAAGCGGAAACAAGTTTTCCCATACGGCAACTACAAGAGCTACTATGGCTATCGAATTGGTCAAGGCGTGGATGAGGACCCTCGATTGAAGGTGCTGAGGAAGGAATGGTTTGAAGGCAAGGACTGTCTTGATATTGGCTGCAACAATGGGATCATCACCATACAGATTGCACAGAAGTTTTGCTGTCAGAGAATTCTCGGAGTTGACATTGATTCTGATCGAGTTGAGGATGCATATTGGAATCTCAGAAAAACTGTTAGGTTGAAATCTACAGGGAATAAACCTGTGAAAGCCTCCAAACTTCAGGACAAGGACCATGCTGATGATTCAGAGAACAGTGTTACTACTTTGTTGAATGTTAAAACGGAGGAGATTTCAAAGGAACATTCTTCTTCAGAGCAAATTGATCTTCTTAAAATAGTTTCGTTTAAACGAGAAAATTTTGTTCAGACTCAACACCCACCAGGAAAGCAGTATGATACAATTCTTTGTTTGAGTGTATCAAAGTGGATACATCTAAATTGGGGGGATGATGGCTTAATTACTTTATTTGCAGAGGTTTGGAAACTGCTCCGTCCAGGTGGCATTTTTGTGCTGGAACCTCAGCCATGGAAGTCATATGAAAGCAATCGTAATGTCTCAGAGACCACTGCTGCCAACTACCGTAATATTATGATTCGACCAGAACAGTTTCAGGAAATATTACTAGATAAGATTGGATTTCGAACAGTTGAAGATATCACTTCAGGTTTGACAGATAGCAAGACTGGTTTCAACAGGCCAATTCTGGTTTTTTGCAAATGA

>Glyma08g03980.1   sequence type=predicted peptide   gene model=Glyma08g03980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESQKQNSKKRKQVFPYGNYKSYYGYRIGQGVDEDPRLKVLRKEWFEGKDCLDIGCNNGIITIQIAQKFCCQRILGVDIDSDRVEDAYWNLRKTVRLKSTGNKPVKASKLQDKDHADDSENSVTTLLNVKTEEISKEHSSSEQIDLLKIVSFKRENFVQTQHPPGKQYDTILCLSVSKWIHLNWGDDGLITLFAEVWKLLRPGGIFVLEPQPWKSYESNRNVSETTAANYRNIMIRPEQFQEILLDKIGFRTVEDITSGLTDSKTGFNRPILVFCK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo