Glyma08g03660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g03660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g03660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g03660

Feature Type:	gene_model
Chromosome:	Gm08
Start:	2598886
stop:	2600437
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g03660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19770	AT	Annotation by Michelle Graham. TAIR10: profilin 5 \| chr2:8519885-8521119 REVERSE LENGTH=134	SoyBase	E_val: 3.00E-74	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0007015	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament organization	SoyBase	N/A	ISS
GO:0030036	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009524	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast	SoyBase	N/A	ISS
GO:0015629	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
GO:0003785	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin monomer binding	SoyBase	N/A	ISS
KOG1755	KOG	Profilin	JGI		ISS
PTHR11604	Panther	PROFILIN	JGI		ISS
PF00235	PFAM	Profilin	JGI		ISS
UniRef100_C6SVT2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Profilin n=1 Tax=Glycine max RepID=C6SVT2_SOYBN	SoyBase	E_val: 9.00E-92	ISS
UniRef100_C6SVT2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Profilin n=1 Tax=Glycine max RepID=C6SVT2_SOYBN	SoyBase	E_val: 9.00E-92	ISS

Expression Patterns of Glyma08g03660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g03660 not represented in the dataset	Glyma08g03660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g03660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g032600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g03660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g03660

Limit To All Plant Sequences

>Glyma08g03660.1   sequence type=CDS   gene model=Glyma08g03660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTGGCAAGCGTACGTGGATGATCACCTGCTGTGTGAAATCGAAGGTAACCACCTCACTCACGCCGCTATTATCGGCCACGACGGCAGCGTTTGGGCTCAGAGCGCCAACTTCCCTCAGTTCAAAGCTGAGGAAATAACTGCTATCATGAATGACTTTAACGAGCCTGGATCACTTGCTCCAACTGGATTGTTTCTCGCTGCCACCAAATACATGGTCATCCAGGGCGAGCCTGGTGCCGTCATTCGAGGCAAGAAGGGTCCTGGTGGTGTTACTGTGAAGAAGACCGGTGCGGCCTTGATCATTGGCATTTATGACGAACCAATGGCTCCGGGTCAGTGCAACATGGTAGTGGAAAGGCTTGGTGATTATCTCATTGAACAGGGTCTCTAA

Predicted protein sequences of Glyma08g03660

Limit To All Plant Sequences

>Glyma08g03660.1   sequence type=predicted peptide   gene model=Glyma08g03660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSWQAYVDDHLLCEIEGNHLTHAAIIGHDGSVWAQSANFPQFKAEEITAIMNDFNEPGSLAPTGLFLAATKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMAPGQCNMVVERLGDYLIEQGL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain