SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g02821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g02821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g02821

Feature Type:gene_model
Chromosome:Gm08
Start:1933344
stop:1935128
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02821
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10350AT Annotation by Michelle Graham. TAIR10: DNAJ heat shock family protein | chr1:3393595-3394860 REVERSE LENGTH=349 SoyBaseE_val: 1.00E-41ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
PTHR24077Panther FAMILY NOT NAMED JGI ISS
PTHR24077:SF88Panther JGI ISS
PF00226PFAM DnaJ domain JGI ISS
PF01556PFAM DnaJ C terminal region JGI ISS
UniRef100_B9S2E0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Curved DNA-binding protein, putative n=1 Tax=Ricinus communis RepID=B9S2E0_RICCO SoyBaseE_val: 2.00E-42ISS
UniRef100_I1K683UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K683_SOYBN SoyBaseE_val: 4.00E-86ISS

Expression Patterns of Glyma08g02821
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g02821 not represented in the dataset
Glyma08g02821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g02821 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g02821
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02821
>Glyma08g02821.1   sequence type=CDS   gene model=Glyma08g02821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTGGTGACTACTACAAAAAACTGAAGGTGAGGCATGATGCCACGGATGAAGAGTTGAAGAAGGCTTATAAAAAGAAGGAAGAGTTTGAGGCCAAGTTCAAGCAGGTTTCTGAGGCCTATGATGTGCTCAGTGACCCTAAGAAGCGCCAGTTGTATGACTTTTACGAAGAAATCTTGAAGATAGACATAAAACCTGGTTGGAGAAAGGGCACAAAAATCACTTTTCCTGGGAAATGCAACAAAGAACAATGGCCTCATGCTATTTTCAAGAGGGAAAGAAATGATCTTGTAGTGATCCAGAAGATATTACTTGTAGATGCTCTCAAAGGAAAGACTCTCAACTTGACTACCTTGGATGGAAGAGATCTCACAATCCAAGTCACAGATATTGTAAAATCAGGCTATGAGCTGGTGAAACCTGGCAAGAAAGGAAATCTCAGAATCAAGTTTGATGTTATGTTTCCATCAAGGATGACCACACAGCAGAAGTGGGATCTAAGAAGGATTCTCAGTGGTGCTGATTACTAA
Predicted protein sequences of Glyma08g02821
>Glyma08g02821.1   sequence type=predicted peptide   gene model=Glyma08g02821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAGDYYKKLKVRHDATDEELKKAYKKKEEFEAKFKQVSEAYDVLSDPKKRQLYDFYEEILKIDIKPGWRKGTKITFPGKCNKEQWPHAIFKRERNDLVVIQKILLVDALKGKTLNLTTLDGRDLTIQVTDIVKSGYELVKPGKKGNLRIKFDVMFPSRMTTQQKWDLRRILSGADY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo