SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g02600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g02600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g02600

Feature Type:gene_model
Chromosome:Gm08
Start:1767219
stop:1769709
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G41850AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr5:16756698-16757791 REVERSE LENGTH=224 SoyBaseE_val: 1.00E-108ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR13136Panther TESTIS DEVELOPMENT PROTEIN PRTD JGI ISS
UniRef100_B6U7E1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Esterase/lipase/thioesterase family protein n=1 Tax=Zea mays RepID=B6U7E1_MAIZE SoyBaseE_val: 2.00E-97ISS
UniRef100_I1KPJ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPJ2_SOYBN SoyBaseE_val: 3.00E-165ISS

Expression Patterns of Glyma08g02600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g02600 not represented in the dataset
Glyma08g02600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g02600
ParalogEvidenceComments
Glyma05g36950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g02600 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g022100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g02600
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02600
>Glyma08g02600.1   sequence type=CDS   gene model=Glyma08g02600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGTTACCACCTGCAAAACGGCGTCGTGAGAGCAAAGACGGCGAGACTGAAGCTTCAACGTTGTCACCGGTTGTGATCTTCGCTCACGGTGCCGGTGCTCCTTCCTCTTCTGATTGGATGCAAAGATGGAAGAACATGATAAAGGAGGCACTGCGCGCTGTCGATGTTGTCACTTTTGACTATCCTTACATGTCTGCGAAAAAGAAGGCCCCTCCTAAGGCGGAAAAACTGGTGGAGTTTCACTCAAATTTTGTCAAGGAAACTGCAACTAAGTACCCTGGTCATCCCCTGATACTTGCAGGCAAATCAATGGGTTCAAGAGTTGGCTGCATGGTGGCTAGCATGAAAGACATTAATGTTTCTGCTGTAGTATGCTTGGGCTACCCATTAAAGGGAAGCAATGGTGCAGTTAGAGATGAAACACTGTTACAGCTAACAGTTCCTACAATGTTTGTACAGGGCAGCAAGGATGGTCTCTGTCCACTTGAGAAGTTAGAAACCACTCGGAAGAAGATGAAAGCACCCAATGAGCTGCATGTCATCGATGGTGGTGACCACTCTTTCAAGATTGGTAAGAAGCACCTGCAAGCAAACAATTCCACCCAAGATGAAGTTGAAGATGTTGCTGTGCTGGCTATTGCTGCTTTCATTTCCAGGTCTCTTGAAGGATGA
Predicted protein sequences of Glyma08g02600
>Glyma08g02600.1   sequence type=predicted peptide   gene model=Glyma08g02600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSLPPAKRRRESKDGETEASTLSPVVIFAHGAGAPSSSDWMQRWKNMIKEALRAVDVVTFDYPYMSAKKKAPPKAEKLVEFHSNFVKETATKYPGHPLILAGKSMGSRVGCMVASMKDINVSAVVCLGYPLKGSNGAVRDETLLQLTVPTMFVQGSKDGLCPLEKLETTRKKMKAPNELHVIDGGDHSFKIGKKHLQANNSTQDEVEDVAVLAIAAFISRSLEG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo