Glyma08g02345 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g02345): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g02345): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g02345

Feature Type:	gene_model
Chromosome:	Gm08
Start:	1636268
stop:	1637516
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g02345

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23690	AT	Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein \| chr4:12339152-12339715 REVERSE LENGTH=187	SoyBase	E_val: 7.00E-60	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009807	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignan biosynthetic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0050790	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of catalytic activity	SoyBase	N/A	ISS
GO:1901599	GO-bp	Annotation by Michelle Graham. GO Biological Process: (-)-pinoresinol biosynthetic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0042349	GO-mf	Annotation by Michelle Graham. GO Molecular Function: guiding stereospecific synthesis activity	SoyBase	N/A	ISS
PTHR21495	Panther	NUCLEOPORIN-RELATED	JGI		ISS
PTHR21495:SF5	Panther	DISEASE RESISTANCE RESPONSE PROTEIN-RELATED	JGI		ISS
PF03018	PFAM	Dirigent-like protein	JGI		ISS
UniRef100_D2JWM8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plant disease resistance response protein (Fragment) n=1 Tax=Populus balsamifera RepID=D2JWM8_POPBA	SoyBase	E_val: 3.00E-94	ISS
UniRef100_I1KPH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KPH0_SOYBN	SoyBase	E_val: 6.00E-114	ISS

Expression Patterns of Glyma08g02345

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g02345 not represented in the dataset	Glyma08g02345 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g02345 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g02345

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g02345

Limit To All Plant Sequences

>Glyma08g02345.1   sequence type=CDS   gene model=Glyma08g02345   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTCGCAGCGTACAAGATGATGCAGTGCCCCACCGGCATTGACAATTGCGCCGTCGGGTTCCTCACCCACTCCCGCTCTGACTTTGTCCCTCTCCAGCCCGACGACATCGACGTTGAGTGGCCCTCCCGCCCCTGCCACCACGTCGGCTCCCTCCCCAACCTCATCGTCACTGTCGCCAACGTCCTTGAAGTCTACGCCGTCCGCCTCCAGGAGGACCAGTCGCCCAAGGCCGCCATCGACTCCCGCAGCGACACCCTCCTCGACGGCATCGTCGGGGCCTCCCTTGAACTCGTTATCTCTAGAATTATCAGTCAATACATTATTTTAGTAAAAAGCAAGAGGAAGCAATATCATACACCATGCAAACACTTGGTCCTCTTCTTCCACGATATCATATACAACGGAAACAATGCAGCCAATGCAACGTCCGCAATAGTAGGAGCCCCAGAAGGTGCCAATTTAACCATATTGGCAAATCAGTTCCACTTTGGAAACATAGTGGTTTTTGATGACCCCATCACATTGGATAACAACCTTCACTCCAAACCCGTTGGAAGGGCACAAGGCTTTTATATCTATAACACCAAGAATACCTACACTTCCTGGCTTGGATTTACGTTCGTTCTCAATAACACAGACCATGACGGAACCATCACTTTCGCTGGAGCTGACCCCATCATGCAAAAGACTAGAGATATCTCCGTCACTGGTGGCACTGGAGATTTCTTTATGCATAGAGGAATTGCCACAATTATGACCGATGCATTTGAAGGTGAAGTTTATTTCCGGCTTCGTGTTGATATTAAGTTCTACGAGTGTTGGTGA

Predicted protein sequences of Glyma08g02345

Limit To All Plant Sequences

>Glyma08g02345.1   sequence type=predicted peptide   gene model=Glyma08g02345   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFAAYKMMQCPTGIDNCAVGFLTHSRSDFVPLQPDDIDVEWPSRPCHHVGSLPNLIVTVANVLEVYAVRLQEDQSPKAAIDSRSDTLLDGIVGASLELVISRIISQYIILVKSKRKQYHTPCKHLVLFFHDIIYNGNNAANATSAIVGAPEGANLTILANQFHFGNIVVFDDPITLDNNLHSKPVGRAQGFYIYNTKNTYTSWLGFTFVLNNTDHDGTITFAGADPIMQKTRDISVTGGTGDFFMHRGIATIMTDAFEGEVYFRLRVDIKFYECW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain