SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g02250

Feature Type:gene_model
Chromosome:Gm08
Start:1563600
stop:1565896
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11220AT Annotation by Michelle Graham. TAIR10: VIRB2-interacting protein 2 | chr4:6838176-6839578 REVERSE LENGTH=271 SoyBaseE_val: 3.00E-114ISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0071786GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum tubular network organization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0071458GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to cytosolic side of endoplasmic reticulum membrane SoyBaseN/AISS
GO:0071782GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum tubular network SoyBaseN/AISS
KOG1792 KOG Reticulon JGI ISS
PTHR10994Panther RETICULON/NOGO JGI ISS
PTHR10994:SF27Panther RETICULON-RELATED (PLANT) JGI ISS
PF02453PFAM Reticulon JGI ISS
UniRef100_B3TLN1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 24 kDa seed maturation protein n=1 Tax=Elaeis guineensis RepID=B3TLN1_ELAGV SoyBaseE_val: 1.00E-125ISS
UniRef100_C6TGW1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TGW1_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g02250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g02250
ParalogEvidenceComments
Glyma05g37300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g02250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g019300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g02250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02250
>Glyma08g02250.1   sequence type=CDS   gene model=Glyma08g02250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAGCATCACGAACACGAGGAAGTGAAGGGTGAGTCCTTGTTGGAGAAGATTTCTGGGAAGATCCACGACCACGATTCGTCATCTTCGTCGGATTCCGACAACGAGAAAACCAGCGCTTCTGACTCCTTGAAGTCAAAGGTTTTCAGGCTTTTCGGCAGAGAAAAGCCCATTCACCATGTTCTTGGTGGCGGAAAACCGGCCGACGTTTTTCTCTGGAGAAACAAGAAGATATCTGCATCGACACTCGGAGTTGCGACCGCTATATGGGTTCTGTTTGAATTGCTTGAGTACCACCTCCTCACCTTGGTTTGCCACTTCCTGATCCTTGGTCTTGCGGTGTTGTTCTTGTGGTCCAATGCATCCACTTTCATCAACAAGAGTCCACCAAAGATCCCACAAGTGCACATTCCAGAGAAACCTGTTTTAGAATTTGCCTCTGCTCTTAGAGTTGAGATCAACCGGGCTTTTGCGTTGTTAAGGGATATTGCATCTGGAAGGGATCTCAAGAAGTTCTTATCAGTGATTGCTGGATTATGGGTTTTCTCTATTTTGGGTAGCTGGGCCAACTTCTTGACCCTGTTCTACATAGCTTTTGTTTTGCTGCACACTGTGCCTGTGCTTTATGAGAAATATGAAGATCATGTAGACTCTTTTGGTGGGAAGGCAATTGCCGAGATTAAGAAGCAATATGCAGTGTTTGATGCGAAGGTGTTGAGCAAGATACCCAGAGGACCTTTGAAAGATAAAAAGAAAGATTGA
Predicted protein sequences of Glyma08g02250
>Glyma08g02250.1   sequence type=predicted peptide   gene model=Glyma08g02250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEHHEHEEVKGESLLEKISGKIHDHDSSSSSDSDNEKTSASDSLKSKVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDAKVLSKIPRGPLKDKKKD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo