SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g02220

Feature Type:gene_model
Chromosome:Gm08
Start:1546996
stop:1547676
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02220
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46150AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr2:18961424-18962089 FORWARD LENGTH=221 SoyBaseE_val: 1.00E-36ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_C6T559UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T559_SOYBN SoyBaseE_val: 2.00E-163ISS
UniRef100_Q19QU4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plant cell wall protein SlTFR88 n=1 Tax=Solanum lycopersicum RepID=Q19QU4_SOLLC SoyBaseE_val: 2.00E-36ISS

Expression Patterns of Glyma08g02220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g02220
ParalogEvidenceComments
Glyma05g37320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g02220 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g019000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g02220
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02220
>Glyma08g02220.1   sequence type=CDS   gene model=Glyma08g02220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAGAGCCCTGATCAGCAGATGAAGCCCTTAGCTCCATTCGTATCATCAACAAGCCACTTCAGCAGACAAGAAGATCATGATCAGTTTCAAGACACATCCGAACAGAAAATCATTCGCATAAGAAAGTTCGTGTTGTGCTGCGGTTGCTTCACTGCCCTTGTCGTGATACTTGTGGTCGTACTCATAGTCTTGGGCTTCACCGTTTACAATGTCAAAGAACCCGAGGTGAGTATGAATTCGGTTACTCTTGTAAGTGGAACTTTTGCAAACAGTGGTGCCACAAACAACGTTACACTTCTTGCTGATATCTCTGTAAAGAACACAAACGCTTTTACCCTCAGGTTTGGAAAAACTACCACCATTGTTTACTATGGTGGTATGGGAATAGGTGAGGGTACTTCTCCACCGGGTAAGGCCAAGGCAAGAAGGACCATAAGGGTAAACTCGACCTTGGAGATTATGGCAAAGAAGCTTTTAGATATCCCAACTTTGAATATTGACCTCAGGGATCAATCTTTGAATATCAGCAGCTATACCAGGATAGATGGTAAGGTGAAAATACTCAACATGTTTCCGAGGAAGGTTGTGGTTGAGCTTAATTGCACCATTGGATACAACATCACCACTGGGTTGGTCACAAATGGTGACAATTGTCTTGGAACCGTTGATATTTAG
Predicted protein sequences of Glyma08g02220
>Glyma08g02220.1   sequence type=predicted peptide   gene model=Glyma08g02220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQSPDQQMKPLAPFVSSTSHFSRQEDHDQFQDTSEQKIIRIRKFVLCCGCFTALVVILVVVLIVLGFTVYNVKEPEVSMNSVTLVSGTFANSGATNNVTLLADISVKNTNAFTLRFGKTTTIVYYGGMGIGEGTSPPGKAKARRTIRVNSTLEIMAKKLLDIPTLNIDLRDQSLNISSYTRIDGKVKILNMFPRKVVVELNCTIGYNITTGLVTNGDNCLGTVDI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo