SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g02130

Feature Type:gene_model
Chromosome:Gm08
Start:1447896
stop:1450900
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11280AT Annotation by Michelle Graham. TAIR10: 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 | chr4:6864168-6865922 FORWARD LENGTH=495 SoyBaseE_val: 0ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0042218GO-bp Annotation by Michelle Graham. GO Biological Process: 1-aminocyclopropane-1-carboxylate biosynthetic process SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016847GO-mf Annotation by Michelle Graham. GO Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
KOG0256 KOG 1-aminocyclopropane-1-carboxylate synthase, and related proteins JGI ISS
PTHR11751Panther SUBGROUP I AMINOTRANSFERASE RELATED JGI ISS
PTHR11751:SF26Panther TRANSCRIPTION REGULATOR AMINOTRANSFERASE GNTR-RELATED JGI ISS
PF00155PFAM Aminotransferase class I and II JGI ISS
UniRef100_I1KPF3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPF3_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q27ZJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate synthase n=1 Tax=Glycine max RepID=Q27ZJ4_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g02130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g02130
ParalogEvidenceComments
Glyma05g37410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g02130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g018000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g02130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02130
>Glyma08g02130.1   sequence type=CDS   gene model=Glyma08g02130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTTGATGGCTGCGAACCAAACTCAATTGTTGTCTAAGATGGCCATCGGAGATGGACATGGTGAAGCATCCCCATATTTTGATGGATGGAAGGCTTATGATGAAAACCCCTTTCATCCCAAAGAGAATCCTAACGGGGTTATTCAAATGGGTCTTGCTGAGAATCAGCTTACTTCTGATTTGGTTGAAGATTGGATACTGAATAACCCAGAGGCCTCCATTTGCACTCCAGAAGGAATAAATGATTTCAGGGCAATAGCTAACTTTCAGGATTATCATGGTCTACCCGAGTTCAGAAATGCTGTGGCTAAATTCATGGGTAGAACAAGAGGAAACAGAGTCACGTTTGATCCTGATCGTATTGTCATGAGCGGTGGAGCAACTGGAGCACACGAAGTCACTACCTTTTGTTTGGCAGACCCCGGTGACGCATTTTTGGTGCCAATTCCTTATTATCCAGGTTTTGACCGGGATTTGAGGTGGAGAACAGGAATTAAACTTGTTCCAGTTATGTGCGATAGCTCAAACAATTTCAAGTTGACAAAGCAAGCATTGGAAGATGCGTATGAGAAAGCCAAAGAGGATAACATTAGAGTAAAGGGCATGCTCATCACCAATCCTTCAAACCCATTAGGCACAGTCATGGACAGAAACACACTAAGAACCGTGGTGAGCTTCATCAATGAGAAGCGTATCCATCTTGTATCTGATGAAATATACTCTGCAACAGTTTTTAGCCGTCCCAGTTTCATAAGCATTGCTGAGATACTAGAGGAAGACACAGACATCGAATGTGACCGCAACCTCGTTCACATTGTTTATAGTCTTTCAAAGGATATGGGGTTCCCTGGCTTCAGAGTTGGCATCATATACTCTTACAATGATGCTGTGGTCAATTGTGCACGCAAAATGTCAAGCTTTGGGTTGGTGTCAACACAGACTCAGCATCTTTTAGCATCAATGCTAAATGATGATGAGTTTGTGGAAAGGTTTCTGGAAGAGAGTGCAAAAAGGTTGGCACAAAGGCATAGAGTTTTCACTTCGGGGTTGGCCAAAGTTGGCATAAAGTGCTTGCAAAGCAATGCTGGTCTCTTTGTGTGGATGGATTTAAGGCAACTTCTCAAGAAGCCAACGCTTGACTCTGAAATGGAGCTTTGGAGAGTGATCATTCATGAGGTTAAGATCAATGTTTCACCTGGCTCTTCTTTCCATTGCACTGAGCCAGGGTGGTTTAGGGTGTGCTATGCCAACATGGATGATATGGCTGTGCAAATTGCATTGCAAAGAATTCGAACCTTCGTGCTTCAAAACAAGGAGGTCATGGTTCCTAACAAGAAACATTGCTGGCACAGTAACTTGAGGTTGAGCCTCAAAACCAGAAGGTTTGATGATATCATGATGTCACCTCACTCCCCTATACCTCAGTCCCCTTTGGTTAAAGCCACAATTTGA
Predicted protein sequences of Glyma08g02130
>Glyma08g02130.1   sequence type=predicted peptide   gene model=Glyma08g02130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLMAANQTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGGATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALEDAYEKAKEDNIRVKGMLITNPSNPLGTVMDRNTLRTVVSFINEKRIHLVSDEIYSATVFSRPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSSFGLVSTQTQHLLASMLNDDEFVERFLEESAKRLAQRHRVFTSGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIHEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIALQRIRTFVLQNKEVMVPNKKHCWHSNLRLSLKTRRFDDIMMSPHSPIPQSPLVKATI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo