SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g01700

Feature Type:gene_model
Chromosome:Gm08
Start:1072060
stop:1074727
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g01700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11600AT Annotation by Michelle Graham. TAIR10: glutathione peroxidase 6 | chr4:7010021-7011330 REVERSE LENGTH=232 SoyBaseE_val: 4.00E-100ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004602GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity SoyBaseN/AISS
KOG1651 KOG Glutathione peroxidase JGI ISS
PTHR11592Panther GLUTATHIONE PEROXIDASE JGI ISS
PF00255PFAM Glutathione peroxidase JGI ISS
UniRef100_I1KP94UniRef Annotation by Michelle Graham. Best UniRef hit: Glutathione peroxidase n=1 Tax=Glycine max RepID=I1KP94_SOYBN SoyBaseE_val: 6.00E-164ISS
UniRef100_I1KP94UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutathione peroxidase n=1 Tax=Glycine max RepID=I1KP94_SOYBN SoyBaseE_val: 6.00E-164ISS

Expression Patterns of Glyma08g01700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g01700
ParalogEvidenceComments
Glyma05g37900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g01700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g013800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g01700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g01700
>Glyma08g01700.1   sequence type=CDS   gene model=Glyma08g01700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCTCTATTTCAGCCACTCGTATATTCTTCCTCCGCTCAACAACTATAAGATTATCTTCTTCTTCTTCTTCTCTTCAATTCTTCTCCAATCCCAACCGCACCCTCTTCCGTCCCTTTCTTCACACTTCCTTCAAACCACTTCCTTCGTCTTTCTCTTTCCGAACAGATCACACTATGGCCACCTCAAACGCCAAATCAGTCCATGATTTCACCGTTAAAGATGCCAAGGGAAATGATATTAACCTTGGTGACTACAAAGGAAAGGTCCTTATCATTGTCAATGTTGCCTCACAATGTGGCTTGACTAATTCAAATTACACTGAGCTCAGTCAGTTGTATGAGAAATACAAACAGAAAGGTCTGGAAATTCTGGCGTTCCCATGCAATCAGTTTGGGGCACAGGAGCCTGGATCTAATGAACAGATACAAGAGTTTGTTTGTACTCGCTTCAAGGCTGAGTTTCCCGTTTTTGACAAGGTTGATGTGAATGGTGACAAGGCTGCTCCACTGTACAAATATCTAAAATCAAGCAAAGGTGGACTCCTTGGGGATGGCATCAAATGGAACTTCGCCAAGTTCCTTGTTGATAAAGAGGGGAATGTTGTTGATCGCTATGCACCCACAACTTCTCCTCTGAGCATTGAGAAGGACTTGCTGAAGTTGTTGGATGCATGA
Predicted protein sequences of Glyma08g01700
>Glyma08g01700.1   sequence type=predicted peptide   gene model=Glyma08g01700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSISATRIFFLRSTTIRLSSSSSSLQFFSNPNRTLFRPFLHTSFKPLPSSFSFRTDHTMATSNAKSVHDFTVKDAKGNDINLGDYKGKVLIIVNVASQCGLTNSNYTELSQLYEKYKQKGLEILAFPCNQFGAQEPGSNEQIQEFVCTRFKAEFPVFDKVDVNGDKAAPLYKYLKSSKGGLLGDGIKWNFAKFLVDKEGNVVDRYAPTTSPLSIEKDLLKLLDA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo